KEGG   Stereum hirsutum: STEHIDRAFT_134608Help
Entry
STEHIDRAFT_134608 CDS       T03127                                 

Definition
(RefSeq) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shs  Stereum hirsutum
Pathway
shs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    STEHIDRAFT_134608
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shs02000]
    STEHIDRAFT_134608
Enzymes [BR:shs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     STEHIDRAFT_134608
Transporters [BR:shs02000]
 Other Transporters
  Pores ion channels [TC:1]
   STEHIDRAFT_134608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C GST_C_2 GST_C_5 Glutaredoxin Arm
Motif
Other DBs
NCBI-GeneID: 18798369
NCBI-ProteinID: XP_007309478
JGI: Stehi1_134608
LinkDB All DBs
Position
Unknown
AA seq 240 aa AA seqDB search
MPDANIFPYATSEAAKTAEKHQEPQDLVFWSGWFCPYNQRVWIALEEKGIPYQYKEVNPY
HKEEDFLKINPRGQVPALEYKNRPIYESLIICEFLEDAFPEYKPNLLPSDAFNRAHARLW
IDHFTKSVVPALLRLLQAQEKDGQEEALKGVNGALGPLVEQVKGPYFLGEEWSLVDTAIA
PFVVGDYILTEHRRYRREDVGEGQRWKEYVEKLTSRESVVKTCSDKDKYEQLYSQYLKKA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgccggacgctaatatcttcccttacgcaaccagcgaagcagcaaagacggcagagaaa
caccaggaaccgcaagatcttgtgttctggtcaggatggttctgtccgtacaatcaacga
gtatggatcgccctcgaggagaaaggtattccctaccagtacaaggaggttaacccctat
cataaagaggaagatttccttaagatcaaccctcgagggcaagttccagcattggaatat
aagaacagaccaatctatgagtccctgatcatctgcgaattcctcgaagacgccttccca
gaatacaagcccaatctcctcccctccgacgcgttcaaccgcgcacacgcacgtctctgg
atagaccacttcaccaaatccgtcgtgccagcattattacgcctccttcaagcacaggaa
aaagatggccaggaagaggcgctgaagggggtcaacggcgcgttggggccgttagtggaa
caggtgaaaggaccgtatttccttggtgaggagtggagcttggtcgacacggcgatcgca
ccgtttgtggtgggggactatattttgactgagcacaggaggtacaggagggaggatgtt
ggggagggccaaaggtggaaggagtatgtggagaagttgacgagtagggagagtgtggtg
aagacttgcagtgacaaggacaagtatgaacagctatacagtcagtacttgaagaaggca
tag

DBGET integrated database retrieval system