KEGG   Stereum hirsutum: STEHIDRAFT_146600Help
Entry
STEHIDRAFT_146600 CDS       T03127                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
shs  Stereum hirsutum
Pathway
shs00010  Glycolysis / Gluconeogenesis
shs00051  Fructose and mannose metabolism
shs00052  Galactose metabolism
shs00500  Starch and sucrose metabolism
shs00520  Amino sugar and nucleotide sugar metabolism
shs01100  Metabolic pathways
shs01110  Biosynthesis of secondary metabolites
shs01130  Biosynthesis of antibiotics
shs01200  Carbon metabolism
Module
shs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
shs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STEHIDRAFT_146600
   00051 Fructose and mannose metabolism
    STEHIDRAFT_146600
   00052 Galactose metabolism
    STEHIDRAFT_146600
   00500 Starch and sucrose metabolism
    STEHIDRAFT_146600
   00520 Amino sugar and nucleotide sugar metabolism
    STEHIDRAFT_146600
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    STEHIDRAFT_146600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shs04131]
    STEHIDRAFT_146600
Enzymes [BR:shs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     STEHIDRAFT_146600
Membrane trafficking [BR:shs04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    STEHIDRAFT_146600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 YscK
Motif
Other DBs
NCBI-GeneID: 18799565
NCBI-ProteinID: XP_007303339
JGI: Stehi1_146600
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MPASRRGSGSVTLPSGQTLTVHTRTQDEEDLPHATKKTMADHLRKYEVLFTLTPQRMRMI
VEAFKDTLELGLEKKDQVVPMIPTYVFGWPTGEETGDFLAVDLGGTNLRVCLVTLQGDGK
FEITQSKYRLTEEQKQEDGQKLFDFCAECLQTFVSTNFEEGSIKEGELLPLGFTVRFPFS
QDRIDHGELIRWTKGFGAANTEGRDVAEMFRNSLKKYNVPVQLTALINDTTGTLIASHYV
NPRTKIAVIFGTGCNAAYMEKVGKIGKIKDLGIDAEAEMAINCEWGAFDSFEHEHLPRTK
YDVSIDENSNKPGEQAFEKLISGRYLGEILRLVICELIDDGVLFLGQNTYKLEIAYAMDT
AFLSLMESDPTEELLMIIGIFSHFFALETTLAERQFFRALAKLIGRRAARMSACGIAAIV
SKMGYLEDGCSVGADGSLYNKYPGFADRVHEGLCDIFGDKGKNIITHHAEDGSGVGSAII
AAMTKIRKDKGIHVHV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaagtcgcagaggaagcggtagtgttacacttccgagcgggcagacgctgacg
gtgcacaccaggacgcaggatgaggaggatctcccgcatgcgaccaagaaaacgatggcg
gaccatctccgcaaatacgaagtgttgttcacgctcacgccgcagcgtatgcgcatgatc
gtcgaggcattcaaggatacgctcgagctcggtctcgagaagaaagaccaggtcgtgcct
atgatcccgacgtatgtctttggttggccgaccggtgaagaaactggcgacttcctcgcc
gtcgacctcggcggaaccaacctccgcgtctgtctcgtcaccctccaaggcgacggcaaa
ttcgagatcacacagtccaagtaccgcctcacggaagagcagaaacaggaggacggtcag
aagttgttcgatttttgcgcggagtgtttgcagacgttcgtgagcacgaattttgaggag
gggagtattaaggagggagagttgttgcctttggggttcacggtgcgtttccctttttcg
caagaccggatcgaccatggtgagctcatccgctggacgaagggtttcggagcggcgaac
acggaaggaagggacgtcgcggagatgttcaggaattccttgaaaaaatacaacgtcccc
gtgcaactcacagcgctcattaacgacacgaccggcacgctcatcgcgagccactacgtc
aacccgcgcacgaagatagccgtcattttcgggacgggctgtaatgcggcgtatatggag
aaggtgggcaagatcgggaagatcaaggatctcgggatcgatgcggaggcggagatggct
attaattgtgaatggggcgctttcgactcgtttgagcacgagcatctgccgaggacgaag
tacgacgtgtcgatcgacgaaaactcgaacaagccaggcgagcaggctttcgagaaactc
atctcgggtcgctacctcggcgagatcctccggctcgtcatctgcgagctcatcgacgac
ggtgtgctcttcttgggccagaacacgtataagctcgagattgcgtacgcgatggacacg
gcgttcttgagtctgatggagagcgacccgaccgaagaactgctcatgatcatcggaatc
ttctcccacttcttcgcactggagacgacgctcgccgaacggcagttcttccgcgcgctc
gcgaaactgatcggaaggcgtgcggcacggatgtcggcgtgtgggatcgcggcgatcgtt
agtaagatgggatacctcgaggatgggtgcagtgtgggtgcggatggcagtttgtataac
aaatatccgggctttgcggatagagtgcatgaaggcctgtgtgatatctttggggacaag
gggaagaacatcattacacaccacgctgaggatggaagtggtgtcggtagtgcgatcatc
gcagcaatgacgaagatccgtaaggacaagggtatccacgtccacgtctaa

DBGET integrated database retrieval system