KEGG   Stereum hirsutum: STEHIDRAFT_151169Help
Entry
STEHIDRAFT_151169 CDS       T03127                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
shs  Stereum hirsutum
Pathway
shs00052  Galactose metabolism
shs00500  Starch and sucrose metabolism
shs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    STEHIDRAFT_151169
   00500 Starch and sucrose metabolism
    STEHIDRAFT_151169
Enzymes [BR:shs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     STEHIDRAFT_151169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 18800165
NCBI-ProteinID: XP_007298456
JGI: Stehi1_151169
LinkDB All DBs
Position
Unknown
AA seq 946 aa AA seqDB search
MFQAAQAIGYTLESLQSTQHGLTAQLNLAGEACNAFSNDIANLTVEVTYETQSRLHVNIY
DTASQQFTLPEAYFEPRSSPPISTSPTFVNESDLVFNYDSAPFAFWITRRSEPDSSPLFD
TRISSLPETPIAAFVNSTVNGSSTGFDGFPLVFEDQYLQLTSALPVDANIYGLGEVVSSS
GFRRDVSVNGTLQTIWARDDADPVNLNIYGSHTVYLEHRFNETTNTSQSHGVFLSSAAGS
DILLATPPSSNTSLIQYRMLGGTLDLYFLSGPDPKTVIEQYGEVVGKPTWQPMWGFGFHL
CRWGYTNLSELQEQVENMKAANIPLETIWNDIDVYHSLRDFTSDPISYPGDQMREFIANL
TANGQHYIPILDAAVNHAANDTDVYYPFSVGIEKDIFIKNPDGSLYIGQVWPGYTVFPDW
FAENTEEVWTQALTNWSLNGVEFSGLWLDMNEVSSFCVGSCGTGANLSDTSVPITLPGEP
GNLVVDYPEGYNSTISGPSGNITVNGTLTYGAGAAPFSEPAKRALGKRGLGAANETDVDL
NNPPYTIHNGFEGLATHTIATNATHAGGYVELDTHNLWGYMEERATNLALRQIHPGQRPF
MISRSTFPSSGAWTGHWLGDNYSKWAYLQYMISGVLQFQLYQIPMVGSDTCGFNGNTDEE
LCNRWMQASAFVPFYRNHNELSALSQEPYRWDSVAEASRVAMAVRYSMLPYWYTLFANAS
THGTPPVRALFYEFPNEPELFSVSLQWMIGSDILVSPVTTPNVSTVDAVFPGRGTETWRD
WYTHEAVNATSSGTTTLSAPLGYIPVHIRSGAAILLHSQPGYTTNETLQSPYSLLVTLSS
DGSASGSAYIDDGITMPTENSTVSNRTLTFSVNGGSLSIASQGDWQVSQKLDILTVLGVA
SQPTVVNVGGTNVSSGLTYESGVQRLNVTGLGLDLNAEGPIVVSWS
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaagctgcccaggcaatagggtataccttggagtcacttcaatcgactcaacac
ggcctcactgctcaattgaatcttgcgggcgaagcctgcaacgcgttttcaaacgacata
gctaacttgactgtcgaagttacctatgaaacgcagtcaaggctccatgtcaacatctac
gacaccgcgtcgcagcagttcacacttcctgaagcttacttcgagcctcggtcctctcct
ccaatctcgacatcaccaacgttcgtcaatgaatccgatctcgtgttcaactatgactct
gccccattcgccttttggatcacacgtcgctcagaaccagactcctctcccctgttcgat
acccggatctcctcactgcctgaaactccaattgctgcgttcgtcaactccaccgtcaat
ggctccagcaccggatttgatgggttccctctcgtgttcgaggaccaatatcttcagctc
acttccgctcttccggtggatgccaacatctacggtcttggcgaagtggtgtctagcagt
ggcttccggagggacgtaagcgtgaatggaacattgcagaccatttgggctcgcgacgac
gcggatcctgtcaatttgaacatttatggatcacacactgtgtatctagaacatcgcttc
aatgaaaccacgaatacatcccagtcccatggtgtcttcctttcaagcgctgccggatcc
gacatcctccttgcgacaccgccttcctccaacacctccctaatccaataccgcatgcta
ggcggaacccttgacttgtacttcctctcgggtccggatcctaagactgtgatcgaacag
tacggcgaggttgtgggcaagccgacttggcagcctatgtggggctttggtttccatctc
tgccgttggggatatacgaatttgtcggaattgcaggaacaagtggagaacatgaaagct
gcgaacatccctctcgagaccatctggaacgatatcgatgtctaccattcacttcgtgac
tttacctctgacccgatcagctatcctggcgaccaaatgagggaattcatcgcgaaccta
actgccaatggccagcattatatccccattttggacgcagctgtcaaccacgccgcgaac
gataccgacgtctactatcccttctcggtcggcatagagaaggacattttcatcaagaat
ccagacggttctctgtatatcggtcaagtgtggcccggatatactgtgttcccagactgg
ttcgcagaaaatactgaggaagtttggacgcaagccctcacgaactggtcgctcaatggt
gttgaattttctggtttgtggctggacatgaacgaagtcagttccttctgcgtgggttca
tgtggaactggagcgaacctctcggatacgtccgttcctatcaccctacccggagaacct
ggcaatctggtcgttgattatcctgagggatacaactccacgatctcaggacctagtggc
aatatcaccgtcaacggaaccttgacatacggtgctggagcagcgccattctctgagcct
gcgaaacgagctctcggaaaacgcggtctaggagcagccaacgaaaccgatgtcgacctt
aacaacccgccctacaccattcacaacggtttcgagggcctcgccacccacacgattgct
accaatgcaacgcatgccggaggttacgttgagctcgacacccataacctttggggatat
atggaggaacgggcgacgaaccttgcacttaggcagatccatcctgggcagcgtcctttc
atgatcagtcggtcgactttcccaagttcgggagcttggactggacactggctcggggat
aactatagcaagtgggcgtatttgcagtacatgatctcgggtgtccttcaattccagttg
taccaaattccaatggttggatctgacacttgcgggttcaacggtaacaccgacgaggag
ctctgtaaccgctggatgcaagcttcagccttcgtacccttctatcggaaccacaacgag
ctcagcgctctctcccaagagccttaccgttgggatagcgtcgctgaggccagtcgtgtg
gcgatggcggtacggtactctatgctgccttactggtacaccttgttcgcgaatgcctcc
acacacgggacgcctcccgtgcgagccttgttctatgagttcccgaacgagccagaactc
ttcagcgtctccctgcaatggatgattggaagcgacatcttggtttccccagtgacaact
ccgaacgtctccactgttgacgctgtattccccggccgcggcactgaaacctggcgtgac
tggtacactcacgaagctgtgaacgccacatcgagtggcaccaccactctttcggctcca
ttgggctacatcccagtccacatccgctccggagctgctatccttcttcactcccaacct
ggatacacgaccaacgagacgctccaatctccttactcccttctcgtcacactctcctct
gacggctctgcctccgggtccgcgtatatcgacgatggaatcaccatgcccaccgaaaac
agcacggtctccaaccggacgcttactttctccgtcaacggcgggagcttgagcatcgcc
agccaaggcgactggcaggtctcgcagaagttggatattttgactgtgctcggagtcgca
agccagccgaccgtggtcaacgtgggagggacgaacgtgtcgagtggcctgacgtatgag
agtggagtgcagaggttgaatgtgacggggttgggattggatctcaatgcggagggtccg
attgtcgtgagttggagttga

DBGET integrated database retrieval system