KEGG   Stereum hirsutum: STEHIDRAFT_168902Help
Entry
STEHIDRAFT_168902 CDS       T03127                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase complex E1 component mitochondrial precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
shs  Stereum hirsutum
Pathway
shs00020  Citrate cycle (TCA cycle)
shs00310  Lysine degradation
shs00380  Tryptophan metabolism
shs01100  Metabolic pathways
shs01110  Biosynthesis of secondary metabolites
shs01130  Biosynthesis of antibiotics
shs01200  Carbon metabolism
Module
shs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STEHIDRAFT_168902
  09105 Amino acid metabolism
   00310 Lysine degradation
    STEHIDRAFT_168902
   00380 Tryptophan metabolism
    STEHIDRAFT_168902
Enzymes [BR:shs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     STEHIDRAFT_168902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 18803415
NCBI-ProteinID: XP_007304773
JGI: Stehi1_168902
LinkDB All DBs
Position
Unknown
AA seq 1004 aa AA seqDB search
MLNRRALLRLRPSATGRYKLAHVSQGSVLVQRALATPAKAPSPNDPFANGTNAYYAEEMY
RHWRQDPSSVHASWDAYFKGLDKGLGANAFQPPPRFLPAPADGAPALHASGGAQLDDHLK
VQLLVRAYQVRGHHVAELDPLGILDADLQDVNPPELELSHYGFSERDLDKEITLGPGILP
HFMTDDRSTMPLRDIIKTLKRIYCGAVGIQYIHIPDKDQCDWIRQRVEIPKPWNYTVEEK
RMILDRLMWSESFEKFISMKYPNEKRFGLEGCEALIPGMKALIDRSVDHGVKHVTMGMPH
RGRLNVLANVIRKPIEAILNEFSPSTEDSDPGGDVKYHLGANYIRPTPSGKKVALSLVAN
PSHLEAEDPVVLGKTRGIQHFENDETNHVTAMGVLLHGDAAFAGQGVVYETMGFHNLPSY
GTGGTIHLIVNNQIGFTTDPRFARSTPYPSDIAKSLDAPIFHVNGDNVEAVTFVCQLAAD
YRAKFKKDVVIDIVCYRRYGHNETDQPSFTQPRMYKAIEKQPTPLTQYTKFLVNRGTFTE
KDIEEHRKWVMGMLETAANAAKDYAPTSKEWLSAPWQGFPSPKQLAEETLPTRPTGVDEE
TLKHIGQTISTYPPNFKVHRNLSRILNGRGKTVQEGQNIDWSTAEALAFGSLALEKKHVR
VSGQDVERGTFSQRHAILHDQENEAQYVPLNNLGNNQARFVVCNSSLSEFGALGFELGYS
LVSPDALTIWEAQFGDFANNAQCIIDQFIASGERKWLQRTGLVMSLPHGYDGQGPEHSSA
RMERFLQLCDDHPHVFPTAEKIERQHQDCNMQIVYPTTPANYFHVLRRQIHRDFRKPLVV
FFSKSLLRHPKARSSLDEMTGETTFQRYLPEESPDLVAPDQIRRHILCTGQVYQTLLAER
EEKGIKDVAISRIEQISPFPYDLVTPHLDQYPNADLLWCQEEPLNNGAWTYVGPRIYTAG
KETKHHQGKYPLYAGREPTSSVATGSKIQHKKEIEAFLATAFGS
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacagacgagctctccttcgcctccgcccctctgcgacgggcaggtacaagctc
gcgcacgtgtcccagggctccgttcttgtccagcgtgcccttgcgactcccgcaaaggca
ccttctcccaatgacccgtttgctaacggcaccaatgcgtactatgcagaggagatgtat
cgtcactggagacaggacccgtcctcggtacatgcttcttgggatgcttactttaagggc
ctcgacaagggcctcggggcaaacgccttccagcccccacccagattcctaccagctccc
gcagatggtgcaccagctctccatgcttctggtggtgctcagctcgatgatcatctcaag
gtgcaacttctcgtccgtgcctaccaagtccgtggacatcacgtcgcagaactcgacccc
ctcggaattctcgatgccgacctccaggacgtcaaccctccggaactcgaacttagccat
tacgggttctccgagcgggatctcgacaaggagatcacccttggccccggtatcctcccc
cacttcatgaccgatgataggtcaacgatgccactccgtgacatcatcaagaccttaaag
agaatctactgcggtgcggttggcatacagtacatccatatcccggacaaggatcagtgc
gactggatccgtcaacgcgttgaaattcctaagccttggaactacactgtcgaggagaag
cgcatgatcctcgatcgccttatgtggtcagaatcattcgagaaatttatctcgatgaag
taccccaacgagaagcgtttcggtcttgaaggttgcgaggccctcatccccggtatgaaa
gctctcatcgataggtctgtcgatcatggcgtcaaacatgtcaccatgggcatgccccac
cgtggccgtctcaatgtcctcgcgaatgtcatccggaaacccatcgaggctatcctcaac
gagttctcgccctccaccgaggactcggatcccggaggagacgtgaaataccatcttggt
gcaaactatattcgtcccacaccctctggaaagaaggtcgctctttctctcgttgcgaac
ccgtcccatcttgaagccgaggatcccgtcgtactcggcaagactcgtggcatccaacac
tttgagaacgacgaaaccaaccatgtcactgcgatgggtgtccttcttcacggagacgct
gcgtttgctggccagggcgtcgtctacgagaccatgggcttccacaacctcccttcttat
ggtactggtggaaccattcatctcattgtcaacaaccagatcggtttcaccactgatcct
cgcttcgcccgctcgacgccctatccgtcggatatcgccaagtctctggatgctcccatt
ttccacgtcaacggcgacaatgtcgaggccgttaccttcgtgtgtcagctcgccgccgat
tatcgtgccaagttcaagaaagacgtcgttatcgacatcgtctgctatcgtcgttacgga
cacaacgagacggaccagcctagttttacgcaaccccgcatgtacaaagccatcgaaaag
cagcccactccgctcacccaatacaccaagttcctcgtcaaccgcggcacgttcacggag
aaggatatcgaggagcacaggaagtgggtcatggggatgctagagactgccgccaacgct
gcgaaggactacgccccaactagcaaggaatggctttccgctccctggcagggcttcccc
tctcccaagcagctcgcggaggagactcttcccacccgtcctactggtgtagacgaagaa
acgctcaagcacatcggtcaaaccatctccacgtatcctccgaacttcaaagtccatcgc
aacctttctcgtatcctgaacggtcgtggcaagactgtccaagaaggccagaatatcgat
tggtccaccgctgaggcccttgcattcggctcccttgctctcgagaagaagcatgtgcgt
gtatcaggccaggacgtcgaacgcggcaccttctctcaacgtcatgctatcctccacgat
caagagaacgaggcccagtatgttcctctcaacaatctcggcaacaaccaggcccgtttc
gtcgtctgcaattcttccctttctgagttcggcgctctcggcttcgagttgggatactcc
ctcgtttctcctgacgccctgactatctgggaggcgcagttcggtgatttcgccaacaat
gcgcaatgcatcattgaccagttcatcgcctcgggggaacgcaaatggttacagcgcacc
ggtctcgtcatgagtcttcctcacggttatgacggccagggcccggagcactctagtgct
aggatggagcgcttcttgcaactctgtgacgaccatcctcatgtattccctacagcagaa
aagatcgagaggcaacatcaagattgcaacatgcagatcgtgtatcccaccacgcctgcc
aactatttccatgtccttcgtcgtcaaattcaccgtgatttccgcaaaccgctcgtcgtg
ttcttctccaagtctctgttgcgccaccctaaggcccgctcgtcgctggatgagatgacg
ggcgagacgaccttccagagatacctcccagaggaatctccagatctggttgcccccgat
cagattagacgacacattctttgcactggtcaagtttatcaaactctcctcgcggagcgg
gaggagaagggtatcaaggacgtcgcgatcagcaggatcgagcagatctcacctttccca
tacgatctcgtcacacctcatcttgaccagtacccgaacgcagaccttctatggtgtcag
gaggagccgctcaacaatggcgcctggacttacgtagggccccgtatctacacggccggc
aaggagacaaagcaccaccagggcaagtaccctctctacgccggtcgggagccaacgagt
tccgtcgccaccggaagcaagatccagcacaagaaggagatcgaagccttccttgcgacc
gctttcggatcatga

DBGET integrated database retrieval system