KEGG   Stereum hirsutum: STEHIDRAFT_58599Help
Entry
STEHIDRAFT_58599  CDS       T03127                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
shs  Stereum hirsutum
Pathway
shs00500  Starch and sucrose metabolism
shs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STEHIDRAFT_58599
Enzymes [BR:shs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     STEHIDRAFT_58599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18805666
NCBI-ProteinID: XP_007304622
JGI: Stehi1_58599
LinkDB All DBs
Position
Unknown
AA seq 575 aa AA seqDB search
MRLLPFVSLALATTALAASVDDYVATEGPIAEAGLLANIGPDGSKSSGALAGIVIASPST
TSPDYLYTWTRDSSLVFKVVVDQVVAGNTSLQGLVDDFVTAEATLQQVSNPSGTVSTGGL
GEPKFNIDETAFTGAWGRPQRDGPALRSTAIIEYATWLYNSGNTTYVSNTLWPIIKLDLD
YVASNWNQTTYDLWEEVSSSSFFTTAVQHRALRQGATFATLIGQTSVVSNYQTQAANLLC
FLQSYWNPTGAYITANTGGGRSGKDANTILTSIHTFDVDAGCDDVTFQPCSDKALSNLKV
YVDSFRSIYTINSGISSTSAVATGRYPEDSYYNGNPWYLTTLAVAEQLYDALSTWTALGS
LNVTSTSLAFFQQFDSSVTAGTYASSSTTYSTLTAAIKDFADGFVTIVADYTPSTGELSE
QYSKADGSQLSAVDLTWSYASAVTAFAARSGATETWGAAGLTAPSTCSTGGSGSGGSSGD
TIAVTFTVDATTTYGENIYLTGSVSELSNWSTTSALLLSAANYPEWSITVNLPPSTAIQY
KYIRIFNGAVTWESDPNLSITTPSSGTYSTSDTWR
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttctcccattcgtgtctctggcattggcgactacagctttggcagcctctgtt
gatgactatgtcgcaacagagggcccaattgctgaggctggcttgctcgccaacatcgga
cccgatggttcgaagtcttccggtgctctcgctggtattgttattgcgtcgccgagcacc
actagcccggattacctctatacttggacgcgtgattcatccctcgtattcaaggtggtc
gttgaccaggttgtcgccggcaatacctctctccaaggtctcgtcgacgatttcgttacc
gcggaggcgacgctgcaacaggtctccaacccgtctggcactgttagcacgggtgggtta
ggcgaaccaaaattcaatattgatgaaacggctttcaccggtgcgtggggacgccctcaa
cgcgatggcccagctttacgatcgaccgctatcattgaatacgccacttggctttacaac
agcgggaacaccacctatgtttccaacacgctgtggcccattatcaagctcgacttggac
tatgttgcttctaactggaaccagacgacttatgacctctgggaggaagttagctcttcg
tctttcttcacgaccgccgtccagcaccgtgctttgcgccaaggtgccacatttgccaca
ctgattggacagacgagcgtggttagcaactaccagacccaggccgccaacttgctttgc
ttcttgcagtcctactggaatcctacgggtgcttacatcacggccaacactggtggcgga
cggtccggcaaggacgccaacaccattcttaccagtatccatacgttcgatgttgatgcc
ggatgtgatgatgtcaccttccagccctgctccgacaaggccttgtctaacttgaaggtt
tacgtcgactccttccggtccatctacaccatcaactctggtatcagctcgacctctgct
gttgccactggtcgttaccccgaagactcttactacaacggcaacccctggtatcttacc
actcttgctgtcgctgagcagctctacgatgctctgtcgacctggactgcgttgggctcg
ttgaacgtcacctctacctcgctcgccttcttccaacaattcgactcttccgtgaccgct
ggcacctacgcttcctcctccaccacctacagcactctcaccgccgccatcaaggatttc
gccgacgggtttgtaactatcgttgcggactacaccccttccaccggcgaactgtctgaa
cagtactccaaggccgacggtagccagctcagcgccgtcgatttgacttggagttatgcg
agtgccgttaccgctttcgccgcgaggtctggtgctactgagacctggggtgcagctggt
cttacggctccttcgacatgctcgaccggcggatccgggtccggagggtcgtctggcgac
actattgcagtcactttcactgtggacgctaccaccacttacggagagaacatctacctt
accggctccgtgagcgagctgtcgaactggagcactacgagcgcgctcttgctctccgcg
gccaactaccccgagtggagcatcaccgtcaacctcccccccagcaccgccattcagtac
aagtacatccgcatcttcaacggagctgtgacctgggagtctgacccgaacctgtcgatt
actaccccctcgtcggggacgtacagcacctctgacacttggcgctga

DBGET integrated database retrieval system