KEGG   Stereum hirsutum: STEHIDRAFT_74820Help
Entry
STEHIDRAFT_74820  CDS       T03127                                 

Definition
(RefSeq) cAMP dependent protein kinase
Organism
shs  Stereum hirsutum
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 18806860
NCBI-ProteinID: XP_007300613
JGI: Stehi1_74820
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MDPSPFAAAGRSSSLPTNSTSGKRTMLSFPSSPRDNTAVAGDAPITPPMTPASSDIPTDE
AESEDGQPDQRPVIPVQSDAEGTDAYMESDDGSNLAPHSPPRPPLRKLENEQEHIHPYLK
LTDFEVKGTLGTGTFGRVLLVRLRTAPSDARATNCFAMKVLRKTEVIRLRQVEHVKAERH
ILSRVRHPFIVDLYATFQDSLNIYMLLSYVPGGELFTHLRRAGRFTADVTRFYLATIVLA
LKYLHSFNIIYRDLKPENLLLDSRGYLRLTDFGFAKIVDDRTWTLCGTPEYLAPEIIQSD
GHGKPADWWACGILAYEMMVGYPPFFDENAYGIYEKILKGKVHWPKEMDPLSRDLIKGFL
HPDRSKRLGNLIAGPQDVLEHMWFRGVDWDALERRDIRAPIVPQVTSLDDTRYFTRLPLP
PPEDVPGLLREERNPPLHERFDMIGFQFGEF
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggacccttctcccttcgctgctgccggtcgctcatcctccctccccaccaactctaca
tccggaaaacgcacgatgctctccttcccctcctctccaagagacaacacagccgtagca
ggagatgcgcccatcacacctcccatgacgcccgcatctagtgacatacccactgatgaa
gccgagtcggaggatggtcagccagaccagcgccccgtcattcccgtccaatccgatgca
gaaggcacggacgcctacatggagagcgatgacggatctaatctggcccctcactcccct
ccgagacctccccttcgtaaattggagaacgagcaggagcacatacatccctatttgaag
ttgaccgacttcgaggtcaaggggacactaggtactggtaccttcggtcgcgtcctcctt
gtccggctccgcaccgcacccagtgacgctcgcgccacaaattgcttcgcgatgaaagtt
cttcgcaaaacagaagtcatccgtctccgccaggtcgaacatgtgaaggcggagagacat
attctatcccgcgtccgtcatcccttcatcgtcgacctgtatgccacgttccaggacagc
ctcaacatctacatgctcctgtcctacgttcctggtggcgagctgttcacccatctccgt
cgtgctggtcgcttcacagcggatgtcacccgcttctacctcgccaccattgtccttgca
ctcaagtacctacattccttcaacatcatctatcgcgacctcaagccagagaacctcctc
ctcgactcgcgcggttacctccgactcaccgactttggatttgcaaagatcgtcgatgac
cgtacttggacgttgtgtggcacccccgaatacctagctcccgagatcatccagtccgat
ggacacggaaaacctgcggactggtgggcatgcggcattttggcgtacgagatgatggtt
ggctatccaccgttctttgatgagaacgcgtacggtatctacgagaagatcctaaagggc
aaagtgcactggcccaaggagatggacccactttcaagagatctgatcaagggattttta
catcctgatcgcagcaagcgacttgggaatctgatcgcggggccacaggacgttttggag
cacatgtggttccgtggggtagattgggatgccttggagcgtcgagatatccgagctccc
atcgtcccccaagtcacatcgttggacgatacacgatacttcacccgtctacccctccca
ccacccgaagacgtccctggtcttctccgagaggagaggaatccaccgttgcatgaacgc
ttcgacatgattggcttccagtttggcgaattctga

DBGET integrated database retrieval system