KEGG   Stereum hirsutum: STEHIDRAFT_88328Help
Entry
STEHIDRAFT_88328  CDS       T03127                                 

Definition
(RefSeq) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
shs  Stereum hirsutum
Pathway
shs03030  DNA replication
shs03410  Base excision repair
shs03420  Nucleotide excision repair
shs03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:shs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    STEHIDRAFT_88328
   03410 Base excision repair
    STEHIDRAFT_88328
   03420 Nucleotide excision repair
    STEHIDRAFT_88328
   03430 Mismatch repair
    STEHIDRAFT_88328
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:shs03032]
    STEHIDRAFT_88328
   03400 DNA repair and recombination proteins [BR:shs03400]
    STEHIDRAFT_88328
Enzymes [BR:shs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     STEHIDRAFT_88328
    6.5.1.6  DNA ligase (ATP or NAD+)
     STEHIDRAFT_88328
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     STEHIDRAFT_88328
DNA replication proteins [BR:shs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    STEHIDRAFT_88328
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     STEHIDRAFT_88328
DNA repair and recombination proteins [BR:shs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     STEHIDRAFT_88328
   NER (nucleotide excision repair)
    Other NER factors
     STEHIDRAFT_88328
   MMR (mismatch excision repair)
    Other MMR factors
     STEHIDRAFT_88328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 18807555
NCBI-ProteinID: XP_007311736
JGI: Stehi1_88328
UniProt: R7RVN0
LinkDB All DBs
Position
Unknown
AA seq 822 aa AA seqDB search
MKGPRSNGEPRDTSSSTVQGPSTSTPNTKPSRPQIVEGTHSGNPPRLEQPSPHEIIDVDA
FYDDGPPPERFSGPSLSSKVSVNKVEPSMLVSATVITPIASYPDLGVDPPLFDISAVPLA
DDKAIPYSFLAHTLFTLSTTRSRNIITNSLTNALRTICAVHEPSLMPSLYLLSNSISPPY
LSLELGLGHSIISKAIQNVSGLTPAALKRLYNQKGDPGDVAFEAKANVRTLLPHAPLSIV
GVYQSLLKIATAKGEGSVKHKQSIVEKLLVSAKGEEIRFLVRTLAQHIRVGAVRTTILTA
LARAMALTPPRAVKVRQRPFYASPPLLTRVTNAESTKGKKDVDASRVELEAIYDAAEGLV
KQVFVQHPSYDDIVVGLLAKGLDGLAESVPLTLGIPLHPTLGSPMRSLDDVYERLGNLPF
AAEFKYDGQRAQVHAWKDATGQIFFKLFSRHLEDMTDKYPDIKVLVQHVFASSPETASFI
IDGEIVAVDAKDGSLKSFQELSNRARKAVELHEVTITVCLFAFDLMYLDGKTLLEVPFRQ
RRQMLRSRFPPIALDRPGAARFDHVESVECSGSDADKEAVEEFWIRAVESRCEGLMIKVL
DSGEIVEVSGPRSEKTRRKPLPATYEPDKRTSAWLKLKKDYVTGLGDSFDLVPVGTWHGI
GRKTAWWSPVLLALRDPDSGAMVALCKCMSGFSDGFYKQMKEKYAEDSDNCSRQPLWGEI
EGGYRPAVYFRPHEVWEVRGADITLSPVSVAAKGMVSDRGLSLRFPRFMKVRDDKSIEQA
STPTFLASVYRKQQGKDQSGADDGQLLDPESSDEAEEEEESG
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaccacgctcaaatggagagcctcgtgacacgtcttcctcgacagtccaaggt
ccttccacgtccactcctaatacgaagcctagcagacctcaaatcgtcgagggcactcat
tcaggaaatccgccacgtcttgagcagccctcacctcacgaaattatcgatgtagatgcg
ttttacgatgatggtccgccaccagagcgcttctctggaccgtctttatctagcaaggtg
tctgtcaacaaagttgaaccatctatgctggtctcagcgactgtcattacccctatagcc
agttatccagacttaggggtggacccaccgctattcgatatctctgctgtccctctagca
gatgataaagcgatcccatactcttttctcgcccatacgctgtttactctttcgactacg
agatcacggaacatcatcaccaattctttgaccaacgcccttcgaactatttgcgccgtt
cacgagccgtcactcatgccatcactgtatctactttcgaactcaatatctcctccatat
ctctcgctggaactcggtctggggcactcaatcatctctaaagctattcagaacgtctct
ggtctgacgcccgccgcacttaagaggctttacaatcagaagggcgaccccggagatgtg
gccttcgaagcaaaagccaatgtacggacgctactacctcatgcacctctctcgatcgtc
ggggtttaccagtctttgctcaaaatcgctaccgccaaaggtgaaggttcggtaaaacac
aagcagtcgatcgtcgaaaagctcctcgtctcggccaaaggcgaagaaattcgttttctt
gttcgtacgctcgcccaacatatcagagttggcgcagttcgaactacgatccttacagct
ctggcccgagccatggctcttacgcccccgcgcgctgtcaaggttcgccagcgacccttt
tacgcctcccctccgctgctcactcgtgtcaccaatgccgagtctacgaaaggcaagaag
gatgtcgacgcatctcgcgtggagctggaagctatatatgacgcagcagaaggtctcgtc
aagcaggtatttgtgcaacatccgagttatgacgatatagtggtaggacttctggcgaag
ggactggatggcctcgcagagtctgttcccttgacgttgggcattccgctgcatccgaca
cttggctctcccatgcgctcactcgatgatgtctacgaacgacttggaaacttgccattt
gcagccgagttcaagtatgatggccaaagagcgcaagtgcatgcctggaaggatgcgact
ggtcaaatatttttcaagctcttcagccgacatcttgaagatatgacagacaagtatcca
gatatcaaagtactggtccagcacgtcttcgcgtcttcgccagaaacggcctcattcatc
attgacggcgagattgtcgccgtcgatgcgaaggatggtagcctcaagtccttccaagaa
ttatccaatcgggcgcgcaaggctgttgagctccacgaagttacgatcacagtatgttta
ttcgcttttgacctgatgtacttggatgggaagactttgttagaggttcccttcaggcag
cgacggcagatgctccgcagccgttttccgcccattgcattggaccgaccaggtgctgct
cgcttcgaccatgtcgaaagtgttgaatgctcgggatccgatgcggacaaggaagctgtg
gaagaattttggatcagagcagtggagagccgctgtgaaggtctaatgatcaaggtcctc
gacagcggcgagattgtcgaagtctcgggacctcgatctgagaaaacgaggaggaagcct
ctgccagcaacttacgaacccgataaacgcacttccgcctggctgaaactgaagaaggac
tacgtcactgggttaggagatagttttgacctcgttcccgtagggacatggcacggaatt
gggcgaaagactgcgtggtggagccctgtcctactcgctctcagagacccagactcaggg
gcaatggtagcgctgtgcaagtgcatgtcagggttttcagatggcttctacaagcaaatg
aaggaaaaatacgcagaagactctgacaattgttcccggcagcctttgtggggcgaaata
gaaggagggtacaggccagccgtctacttcaggccacatgaagtgtgggaagttcgaggc
gccgacatcaccttgagtccagtgtccgttgcggcgaagggcatggtgtctgatcgcgga
ttgagcctgcgcttccccagatttatgaaggttagagacgataagtccattgaacaggct
agcacgccgactttcttagcgagtgtctatcggaagcagcaagggaaggatcagtcgggc
gctgatgatggtcaacttcttgaccctgagtcctcagacgaagcggaagaggaagaggaa
tccggttag

DBGET integrated database retrieval system