KEGG   Stereum hirsutum: STEHIDRAFT_90366Help
Entry
STEHIDRAFT_90366  CDS       T03127                                 

Definition
(RefSeq) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
shs  Stereum hirsutum
Brite
Translation factors [BR:shs03012]
 Eukaryotic Type
  Elongation factors
   STEHIDRAFT_90366
 Prokaryotic Type
   STEHIDRAFT_90366
Mitochondrial biogenesis [BR:shs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    STEHIDRAFT_90366
Exosome [BR:shs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   STEHIDRAFT_90366
  Exosomal proteins of breast cancer cells
   STEHIDRAFT_90366
  Exosomal proteins of colorectal cancer cells
   STEHIDRAFT_90366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 18807719
NCBI-ProteinID: XP_007298373
JGI: Stehi1_90366
LinkDB All DBs
Position
Unknown
AA seq 458 aa AA seqDB search
MFRSHLVQPGAVARRLYSSSAVSKALASPCARVASRNTSLLQAASSSKHALRWAPVRGYA
ELFSRAKPHMNIGTIGHVDHGKTTLTAAITKVLSLTGGAKFTDYSQIDRAPEEKARGITI
NSAHVEYETDSRHYGHIDCPGHADYIKNMITGAAQMDGAIIVVSATDGQMPQTREHLLLA
RQVGIKKLVVFINKVDQISDPEMLELVDMEMRDLLGTYNFDGEGTPIVMGSALAALDGRD
PEIGEKKILELVKACDEWLELPPRDLEKPFLMPVEDVFSISGRGTVATGRVERGVATKGA
EVEIVGLGAQFKTTLTGIEMFHKELDRGQAGDNMGALLRGVKREQIHRGMVIIAPGSMKP
VTKFQAQIYVLTKDEGGRYTPFVQNYRPQLFLRTADVTVGLTWPEETADADEKMVMPGDN
VEMVCSLVHEVAAEVGSRFTLREGGKTIGTGIVTKILS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttccggtcacacctcgtgcagcctggggctgtcgcccgcaggctgtattcctcatca
gccgtctcgaaagcgcttgccagcccgtgcgcccgcgtcgcttcccgaaacacttcgttg
cttcaggctgcatcgtcctcgaaacacgcccttcgctgggcgcctgttcgaggctacgcc
gagctgttctcccgcgccaagccgcacatgaacatcggtaccatcggccacgtcgaccac
ggcaagacgaccctgaccgccgccatcaccaaagtactctccctgactggaggtgcgaag
ttcacggactactcccaaatcgacagagccccggaagaaaaggctcgtggtatcaccatc
aactctgcgcacgtagaatacgaaacggactcgcggcactatggacacatcgactgtccc
ggtcacgctgattatatcaagaacatgatcactggtgcggctcaaatggacggtgccatc
atcgtcgtctccgccacggacggtcaaatgccgcaaactcgtgaacatctcctcctcgcc
cgtcaggtcggcatcaagaagctcgtcgtcttcatcaacaaggtcgaccagatctcagac
ccggaaatgctcgagctcgtcgatatggagatgcgcgacttgctcgggacgtacaacttc
gacggagaaggcacgccgatcgtcatgggctctgcgctcgctgccctcgacggacgcgac
cccgaaattggcgagaagaagatcttggagttggtcaaggcttgtgatgaatggcttgag
ctcccccctcgtgaccttgagaagcccttcctcatgcccgttgaagacgttttctctatc
tccggacgtggtaccgtcgcgactggccgtgtcgagcgtggtgtcgccaccaagggtgct
gaagtcgagatcgtcggtctcggtgctcagttcaagacgactcttaccggtatcgagatg
ttccacaaggagttggacaggggtcaagctggcgacaacatgggtgctctcctccgtggt
gtcaagcgtgagcagatccaccgtggaatggtcatcatcgctcctggctccatgaagccc
gtcaccaaattccaggctcagatctacgtcctcaccaaggatgaaggtggacgttatact
cctttcgtccagaactaccgtccccagctcttcctccgtaccgccgatgtcaccgtcggt
ctcacatggccagaggagaccgccgatgctgacgagaagatggtcatgcccggtgataac
gtcgagatggtctgcagtctcgtgcacgaagtcgccgctgaggtcggatcccgcttcact
ctccgtgaaggcggcaagaccatcggtaccggtatcgtgaccaaaattctctcataa

DBGET integrated database retrieval system