KEGG   Stereum hirsutum: STEHIDRAFT_93217Help
Entry
STEHIDRAFT_93217  CDS       T03127                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
shs  Stereum hirsutum
Pathway
shs00020  Citrate cycle (TCA cycle)
shs00190  Oxidative phosphorylation
shs01100  Metabolic pathways
shs01110  Biosynthesis of secondary metabolites
shs01130  Biosynthesis of antibiotics
shs01200  Carbon metabolism
Module
shs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shs_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STEHIDRAFT_93217
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    STEHIDRAFT_93217
Enzymes [BR:shs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     STEHIDRAFT_93217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 Nucleoporin_FG2 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 18807935
NCBI-ProteinID: XP_007301280
JGI: Stehi1_93217
LinkDB All DBs
Position
Unknown
AA seq 638 aa AA seqDB search
MLRKTVSKSVQRSRAFHNSAVARRVVATNPVKAEEVKSWSSGKYPLIEHEYDAIVVGAGG
AGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIHYMTREAPRTVIELEHFGVPFSRTDEGKIYQRAFGGQSLKFGKGGQAYRCAA
AADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMEDGECVGVIALNMEDGTLHRFRAHK
TVLATGGYGRAYFSCTSAHTCSGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPDKDHIYLQLSHL
PPEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVITQDADGKDK
VVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIKETLTPGKPHKKIPEEAGL
HSVENLDKIRNSDGPEPTAKIRLAMQKAMQTDAAVFRTQQTLDEGVVKLKDIYKSYEKVG
IKDRSMIWNSDLVETLELRNILQNAVQTITAAAARKESRGAHAREDYSERDDENWMKHTL
TWQHDVESPEVEIKYRGVIAHTLDEAECKPVPPFKRVY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaaaaccgtgtcgaagagcgtacagcgctcgcgtgcgtttcataactctgct
gtcgctcggagggtcgtcgcgaccaaccctgttaaagcggaggaggtcaagtcttggtcg
tcaggaaagtaccctctgattgagcatgagtatgatgctattgttgtcggtgctggtggc
gccggtctgagagctgctttcggtctcgcggaggctggcttcaacactgcatgcatcacg
aaactattcccgacgagaagtcatactgtcgctgcacagggtggtatcaatgctgcactt
ggtaacatgactgaggacgactggcggtggcatatgtacgataccgtcaaaggttccgac
tggctcggtgaccaggatgccatccattacatgactcgagaggctccacggacagttatt
gagctcgagcatttcggtgtgccattctctcgaaccgacgagggcaagatttaccaacgt
gccttcggtggtcaatctctcaagttcggcaagggtggacaggcctatcgttgtgccgcc
gctgccgaccgtaccggacatgcccttctacacaccctctacggccaatcactgcgccac
aacaccaacttcttcatcgagtactttgcccttgatcttatcatggaggatggcgagtgc
gtcggtgttattgctttgaacatggaggacggtaccctccaccgattccgtgctcacaag
actgtattggctactggaggatatgggcgagcgtacttcagttgtactagtgcgcacact
tgctcgggagatgggaatgccatggtcgcacgtgcaggtcttcctttgcaggacttggag
ttcgtccagttccacccgactggtatctacggcgctggatgtttgatcaccgaaggctct
cgaggagagggaggataccttcttaactctgagggagagcggttcatggagcgttacgct
cccactgcgaaggacttggcctcccgcgatgtcgtatcgcgatccatgaccatcgaaatc
cgtgagggtcgtggtgttggtcccgacaaggaccacatttacctccaactcagccacttg
ccgcctgaggtccttcacgagagattgcctggtatttctgagactgctgctatcttctcc
ggtgtcgacgttaccaaggagcccatccctgtcttgcccaccgtgcattacaacatgggt
ggcattcccaccaaatacaccggcgaggtcatcactcaagacgcagatggcaaggacaag
gtcgtccctggtctttacgctgccggcgaggccgcctgtgtgtctgtccacggagccaac
cgtctcggcgccaactctctactcgacattgtcgtattcggccgtgcctgcgcgcaccac
atcaaggagaccctcacacctggcaagccacacaagaagatcccagaagaagccggtctc
cacagtgtcgagaacctggacaaaatcaggaactccgatggacctgaacccacggcaaag
attcggttggccatgcagaaggccatgcagaccgatgctgctgtgttcaggacgcagcag
acgctcgatgagggcgtcgtcaaactgaaggacatttacaagtcttacgagaaggtcggg
atcaaggacaggagtatgatttggaactccgacctcgtggagacccttgaactccgcaac
attctccaaaatgccgtccagaccatcaccgctgctgccgctcgtaaagagtcgcgtggc
gctcacgcccgtgaggactactcagagcgcgatgacgagaactggatgaagcacactctc
acttggcaacacgacgtcgaatctcctgaggttgagatcaaataccgcggtgtcatcgcc
cacacgctcgatgaggccgagtgcaagcctgtcccgccattcaagcgtgtctactag

DBGET integrated database retrieval system