KEGG   Sphingobacterium sp. ML3W: KO02_02295Help
Entry
KO02_02295        CDS       T03258                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sht  Sphingobacterium sp. ML3W
Pathway
sht00010  Glycolysis / Gluconeogenesis
sht00020  Citrate cycle (TCA cycle)
sht00620  Pyruvate metabolism
sht01100  Metabolic pathways
sht01110  Biosynthesis of secondary metabolites
sht01120  Microbial metabolism in diverse environments
sht01130  Biosynthesis of antibiotics
sht01200  Carbon metabolism
Module
sht_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KO02_02295
   00020 Citrate cycle (TCA cycle)
    KO02_02295
   00620 Pyruvate metabolism
    KO02_02295
Enzymes [BR:sht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KO02_02295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_3 DUF2118 PYNP_C HlyD_2
Motif
Other DBs
NCBI-ProteinID: AIM35629
UniProt: A0A088ET49
LinkDB All DBs
Position
487500..489128
Genome map
AA seq 542 aa AA seqDB search
MAEVVRMPKMSDTMTEGVIAKWHKQVGDKVNSGDLVAEIETDKATMDFESYQEGTLLYIG
PKEGEAVAIDAIIAILGEPGEDFQSLLSDAPQVVAEVEKKEEVSTSSDTAIAPQSDVTPE
SLGVTVITMPLLSDTMTEGVIAQWNFKVGDTIKSDDSIADVETDKATMEVTAYADGTLLY
VGLEAGEAAKVNDIIAIVGPAGTDVTPLLNQKTAVTQPAATEVKEEAKVESGGSVENKAS
DVIDDSRVKASPLARKIAKDKGINLNDVKGSADGGRIVKKDVESYAPAAKSAPVSAASTA
VATETKAISLPSYVGEERYTEVAVSQMRKTIARRLGESLFTAPHFYLTVSIDMENAMLAR
TQINEVAPVKVSFNDIVVKAVAVALKKHPAVNSSWKGDKIRFNEHTNIGVAMAVEDGLLV
PVVRFADGKSLSHISAEVKDFAQKAKTKKLTPADWEGSTFTVSNLGMFGIDEFTSIINSP
DGAILSVGAIQQVPVVKNGAVVPGNVMKLTLGCDHRVVDGANGAQFLQTLKALLENPVRL
LA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagttagaatgccgaaaatgagcgataccatgactgaaggggtcatcgct
aaatggcacaaacaagttggtgataaagttaattctggtgatttagttgcagaaatcgaa
acggataaagcaacaatggattttgaatcataccaagaaggtactcttttatatattggt
ccaaaagaaggtgaagcagtggcaattgatgctattatagctattcttggtgaaccgggt
gaagattttcaatcattattaagtgatgcgcctcaagtggttgctgaagtagagaaaaaa
gaagaggtttcgacttcttctgatactgcaatagctccacaatcagatgttactcctgaa
tcattgggtgtaacagtgattacgatgcctttgctaagcgacacgatgactgaaggtgtt
atagcacaatggaattttaaagttggtgataccataaagtctgatgattcaatcgctgat
gtagagacagacaaagcaacaatggaggtgacggcttatgctgatggcacattgttatat
gttggtcttgaagcgggggaagctgcaaaagtaaatgatatcattgcgattgtaggtccg
gcaggtactgatgtaacaccattgttaaatcaaaaaacggcagttacgcaaccagcagct
acagaggtaaaagaggaagctaaagttgagtcaggtggttcagtggaaaataaagcctct
gatgtaattgacgattcaagagtaaaagcttctcctttagcgcgtaaaatagctaaagat
aaagggattaatttgaacgatgttaaaggttctgctgatggcggacgtatcgtgaaaaaa
gatgttgaatcttacgcgcctgcggccaaatcagctccagttagtgcagcatctactgca
gttgctactgaaacaaaagcgatttctttgccttcttacgtaggagaagaaagatatact
gaagttgctgtctctcaaatgcgtaaaacgattgctcgtcgtttaggtgaaagcttattc
acagctccacatttctacttaactgtaagtattgatatggaaaatgcgatgcttgcgcgt
acgcaaatcaatgaagtagcgccagttaaagtttcattcaatgatattgtagttaaggcg
gtagcggttgctttgaaaaaacaccctgcagtaaactcttcttggaaaggggataagatt
cgttttaatgagcatacgaatataggtgtcgcgatggctgttgaagatggtttattagtt
cctgttgttcgttttgctgatggtaaatctttatctcatatttcagcagaagttaaagat
tttgcacaaaaagctaaaacaaagaaattgactccagctgactgggaaggatctactttt
acggtttcaaatttaggtatgtttggtattgatgagtttacatcaatcattaactctcct
gatggtgcaattttatctgtaggcgcaatccaacaggtgcctgttgttaagaatggtgca
gttgttccaggaaatgttatgaaattgactttaggttgcgatcaccgtgtagttgatggt
gctaacggagctcagtttttacaaacacttaaagctttattggaaaatccagtaagatta
ctggcataa

DBGET integrated database retrieval system