KEGG   Sphingobacterium sp. ML3W: KO02_02625Help
Entry
KO02_02625        CDS       T03258                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sht  Sphingobacterium sp. ML3W
Brite
Enzymes [BR:sht01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KO02_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIM35692
UniProt: A0A088EW49
LinkDB All DBs
Position
539563..540171
Genome map
AA seq 202 aa AA seqDB search
MAFVLEALPYSADALEPHIDKATMEIHHDRHHQAYVDNLNKAIAGTDAENLSLEDIIKNI
SKYPAAVRNNGGGHYNHKLFWTVLGPNAGGEPTGELATAINENFGSFAELKTQLQNAGAT
RFGSGWSWLIVNAEGKLQVTSTPNQDNPLMDVAEVKGTPILGIDVWEHAYYLKFQNKRPA
YLEEIFNVINWDAVAKNYAAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgtattagaggcgctaccatactcggcagacgcattggaaccacatattgat
aaggctactatggaaattcaccatgatagacatcatcaagcatacgtagataacttaaat
aaagcaattgctggtacagacgcagaaaatttgtctttagaagatatcataaaaaatatc
agtaagtatcctgcagcagtacgtaataacggcggtggacattataatcataaacttttc
tggacggtgttaggtccaaatgctggtggagagccaacaggcgaattagcaactgcaatc
aatgaaaattttggttctttcgcagaattgaaaacacaattgcaaaatgctggtgcaaca
cgtttcggttctggttggtcttggttaattgtaaacgcggaaggtaaattacaagtaact
tcaactccaaatcaagacaatcctttgatggatgttgcagaagtaaagggtacaccaatt
ttgggtattgatgtttgggaacatgcatactacttaaaattccaaaataagcgtccagct
tacttagaagaaatcttcaatgtaatcaattgggatgcagtagcaaaaaattatgctgca
gctaaataa

DBGET integrated database retrieval system