KEGG   Sphingobacterium sp. ML3W: KO02_03240Help
Entry
KO02_03240        CDS       T03258                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
sht  Sphingobacterium sp. ML3W
Pathway
sht00620  Pyruvate metabolism
sht01100  Metabolic pathways
sht01120  Microbial metabolism in diverse environments
sht01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KO02_03240
Enzymes [BR:sht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     KO02_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AIM35800
UniProt: A0A088EX81
LinkDB All DBs
Position
complement(678203..680482)
Genome map
AA seq 759 aa AA seqDB search
MSNVNRKQAALDYHSKGRPGKIAVVPTKPTNSQRDLSLAYSPGVAEPCLAIAANNEDAYK
YTAKGNLVAVISNGTAVLGLGDIGAVAGKPVMEGKGLLFKIFADIDVFDIELDTKNVDEF
VNIVKAMEPTFGGINLEDIKAPECFEIERRLKEEMNIPVMHDDQHGTAIISCAALINACE
LIGKKIEDVKIVVNGAGAAAISCTGMYVAAGAKKENIVMLDSKGVIRRDRETLDTMKAMY
ATDRDIRTLADAVDAADVFIGLSAADVLTAEMLLTMANQPIVLAMANPNPEIDYDLALAT
RNDVIMGTGRSDYPNQVNNVLGFPYIFRGALDVRATVINEEMKVAATKAIADLAKQPVPE
EVNLAYNTSNLKFSADYIIPKPNDPRLITEVSVAVAKAAIESGVAKHTIEDWDKYRETLR
KRLGQDDAIMRNLTMAAKRNPKRVVFAEADNYKTLRAAQIVKEEGIAVPILLGKKAKINA
LIAEYSFELSGVQIIDPFEEADSERVNQYVDHLFVKRQRRGLSKLDAKKLLIDRNYFGAS
MVQFGDADTLISGLTKNYANTIKPAIHVIGAKEGSRIAGMYMMLTKKGPIFLGDTTVNKE
PSAKELADITVLLDKAVRRMNVSPRIALLSYSNFGSNEGNTPTKVREAIKIVHKEHPEIV
ADGDLQANFALNSELLEANFPFSTLKGQPANTLVFPNLESGNIAYKLLQEVGDAEAVGPI
LLGMNKPIHVLQLDSSVREIVNMVTIAVVDVQSYEKQGN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgtaaatcgtaaacaagcagcattagactaccactcaaagggtagacctggt
aaaatagcagttgtgcccactaagccaacaaattctcaaagagacttatcgctagcttat
tcaccaggggttgctgaaccttgtttagctatcgctgcaaataatgaagacgcttataaa
tataccgcaaaaggtaatttagttgcagtaattagtaatggtaccgcagtattaggtctt
ggtgatatcggagctgtagctggtaagcctgtgatggagggtaaaggtttgttatttaaa
atctttgctgatatcgatgtttttgatatcgaacttgacaccaagaatgttgatgaattc
gtcaatatcgtaaaggcaatggaacctacttttggaggaatcaacctggaagatattaaa
gcaccagagtgttttgaaatcgaaagacgtctaaaagaggaaatgaatattccagtgatg
cacgatgaccaacatggtacggccattatttcttgtgcagctttgatcaacgcatgtgaa
ttgatcggtaaaaagattgaggatgtgaaaatcgttgtgaatggtgctggtgcagctgct
atttcatgtacaggtatgtatgtggcagcaggtgcaaaaaaagaaaatatcgtcatgttg
gatagcaaaggtgttatccgtcgtgaccgagagacattggatacgatgaaagcgatgtat
gctacggatcgtgatatccgtacgcttgctgatgcggtagatgctgctgatgtattcatc
gggctttcagctgctgatgtcttgactgctgagatgttattgactatggccaaccaaccg
attgtattggcgatggcaaaccctaatccagaaattgattacgatttagcgctagctacg
cgtaacgatgtaatcatgggtacaggccgttcggattatccgaaccaagtaaacaatgta
ctgggcttcccttatatcttccgtggtgctttggacgtacgtgcaacagtaatcaatgaa
gagatgaaagtagcggctactaaagccattgccgatcttgctaaacaacctgttccagaa
gaagtcaacttagcttataatacgagtaaccttaaattctccgcagattacattattcca
aaaccgaatgacccacgtttgatcacagaagtttcggtagcggtagcaaaagctgcaatt
gaatctggtgtggcgaaacataccattgaagattgggataaatatagagaaacacttcgt
aaaagattaggtcaggatgatgctatcatgcgtaatttgaccatggcagcaaaacgcaat
cctaagcgtgttgtatttgctgaagcggataattataaaacacttcgtgctgcgcaaatc
gtaaaagaagaaggtattgcagttccaattttactaggtaagaaagctaaaatcaatgct
ttaattgctgaatatagttttgaattgagcggtgtgcaaatcatcgacccttttgaagaa
gcagattcggaacgtgtaaatcaatatgtcgaccatttatttgttaaaagacaacgtcgt
ggtctttcaaaattagatgctaaaaagcttttaattgaccgcaattacttcggagcaagt
atggtacaatttggagatgcagatacgttaatctctggtttgacgaaaaactatgcgaac
acgatcaagcctgccatccatgttattggagctaaagaaggtagtcgtattgcggggatg
tacatgatgttgacgaaaaaaggtccgatattcttaggagacacaacagtcaacaaagag
ccttctgcaaaagaattagcagatatcaccgtattgttagataaagctgtcagaagaatg
aacgtgagtccacgtattgccttactttcctattctaactttggttctaacgaaggaaat
acaccaacaaaagtacgtgaagcgattaaaatcgtacacaaagagcatcctgaaattgtt
gctgacggtgatttacaagcaaacttcgcccttaatagcgaattgctagaagcaaacttc
ccattcagtactttgaaaggacaacctgcaaatacgttggtattcccgaatttagagtct
ggaaatattgcatataaattattgcaagaggtaggtgatgctgaggctgtaggtccaatt
ctattgggtatgaacaaacctattcacgtattgcaattggatagttcagttcgcgaaatc
gtgaatatggtgactatcgctgttgtagacgttcaatcttacgaaaaacaaggtaactaa

DBGET integrated database retrieval system