KEGG   Sphingobacterium sp. ML3W: KO02_06420Help
Entry
KO02_06420        CDS       T03258                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sht  Sphingobacterium sp. ML3W
Pathway
sht00473  D-Alanine metabolism
sht01100  Metabolic pathways
sht01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KO02_06420
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    KO02_06420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sht01011]
    KO02_06420
Enzymes [BR:sht01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     KO02_06420
Peptidoglycan biosynthesis and degradation proteins [BR:sht01011]
 Precursor biosynthesis
  Racemase
   KO02_06420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AIM36372
UniProt: A0A088EY27
LinkDB All DBs
Position
1442840..1445281
Genome map
AA seq 813 aa AA seqDB search
MYTIADISEIVAPQRSIIVAHESIIQNLIYDTRKIMNAETGLFFALVNRRDGHDFIMDAY
RKGVRNFVLQNDLQQELVLTDANILWVPDTFLALQAIAAFQRKKFKSPVLGITGSNGKTI
VKEWLFQLLSPEYKIYRSPKSYNSQLGVALSLWELNEQYNFAIIEAGISEVGEMARLEKM
IKPTHGVLTNIGVAHREGFQSKEEKIDEKLKLFTDAEVLVYPQKYLEHVYMPSQIYKFAW
GDEESCQLEVYSLKKEDNQSTLVSLCFSRQIFTVKIPFVDQASIENAISCIGVMITFGYD
VKVIAERIATLQPMEMRLELKKGKQNSSIIDDSYSNDLVALQIALDFLKQQKQHLRKILI
LSDIPGVQVKDEKTFGKLKRLISESGLTELIFIGPVLGQLVSQFTLPITNYADTKSFLED
LKHINYSDATILIKGARDYHFEQISKRLVAKSHDTTLEINLNALEHNLNVYRGLLPPGVK
LMAMVKAFSYGSGSFEIANLLQFNHVDYLTVAFTDEGVDLRNGGITLPIVVMSPDENAFD
AIVQHRLEPEIYSFRILNSFIRYLKQHDLKGFPVHIKVDTGMHRLGFMPEEIEALLAVLK
NQEVIRVQSVFSHLASAGNVVDDKFTGNQIQLLDEFTAQLKQELGYSFIRHIAATSGIAL
WPSAYFDMVRLGIGLYGIDLEREDLPVKEVSVLKTNVTQIKQLSATETIGYNRAGVIHRP
SRIATIKIGYADGYDRRFGNGVGKMSINGQIVATVGNICMDMCMLDVTDIEVNEEDEVIV
YPDIKEAALAIGTIPYELLVNISQRVKRVYFYE
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtataccatagcggatatttcggagattgtagcacctcaaagatcgattattgtagcc
catgaatccatcattcaaaatttgatttatgatacgcgtaagatcatgaatgcagaaaca
ggtttgttttttgcattggtcaaccgtagggatgggcatgatttcatcatggatgcttac
agaaaaggtgtccgaaactttgtcttgcaaaatgatctacaacaggagcttgtattgact
gatgccaatatcttatgggtgccagatacatttttggccttacaagcgatagctgctttt
caaagaaagaaattcaaatctccagtcttgggaataacggggagcaatggtaaaaccatt
gtcaaagaatggttattccaattattgtctcctgaatacaagatctaccgtagtcccaaa
agctacaactcacaattaggggttgcattatcactttgggagttaaatgagcagtataac
tttgccatcatagaagcgggtatcagtgaagtaggcgaaatggctaggttggaaaaaatg
attaaacccacgcatggtgtattgaccaatattggtgttgcgcatagagagggcttccaa
tccaaagaggaaaaaattgatgaaaaattaaaactctttacagatgcggaagtattggtc
tatccgcagaaatatttggaacatgtctatatgccttctcagatttataaatttgcttgg
ggtgatgaggagtcctgccaattggaagtgtattccctaaaaaaggaagacaatcaatcg
accttggtcagtttatgtttttcacgtcagatctttactgtaaaaattccttttgtcgat
caagcttccattgaaaatgccatttcttgcattggggtgatgattacctttggatatgat
gtaaaggtaattgctgaacgtatcgcaactttacaaccaatggagatgcgtttggagttg
aagaaagggaaacagaacagttccattatcgatgattcttatagtaatgatttagtggcg
ttgcaaatcgcattggattttttaaagcaacagaagcaacacttgcgtaagatcctgatt
ctatcggatattccaggtgttcaggtaaaggatgaaaagacatttggtaaattgaaacgc
ttgatttcggagagtggattgaccgagttgatttttataggaccggtcttaggtcaattg
gtttctcagtttacattgccgataacaaattatgcagacacaaaatcatttcttgaagac
ctcaagcatatcaattatagcgatgctacgattctgattaaaggtgctcgggattaccac
ttcgagcagatcagtaagcggttggtagcaaaatcgcacgatacgaccttagaaattaat
ctcaatgcgctcgagcataacctcaatgtatatcgcggattattgcctccaggtgttaaa
ttaatggctatggtgaaggctttttcctatggtagtggaagttttgaaatcgctaattta
ttgcagtttaatcatgtggattacttaacagttgcgtttacggatgagggggtggatcta
aggaatggaggcattaccttgcctatcgtggtgatgagcccagatgagaatgcttttgac
gcgatagtgcagcacagattggaacccgaaatctatagttttagaattttgaactctttt
attcgttatctaaagcaacatgatttgaagggatttcctgttcatatcaaagtagatacc
ggaatgcaccgattgggatttatgcccgaggaaatagaggcattgctagctgttttaaaa
aatcaagaagtgattagggtgcagtccgtattctcacatcttgcttctgcaggaaatgtt
gtcgatgataagtttactggaaatcagattcagttgttggacgagtttacggctcagtta
aaacaggaattaggctattcatttattcgtcatatagccgcaacttctggaattgcttta
tggccttcggcttattttgacatggtccgcctgggaattggtctttatggaatagacttg
gaaagagaagacttgcccgtgaaggaagtgagtgtgctgaaaacgaacgttacacagata
aaacaattgtcggctacggagaccatagggtacaatcgagcaggagtaatacatcgacct
agtcgtattgcaacgattaagattggttatgccgatggttatgatcgtcgttttggaaat
ggggtagggaagatgtccattaatggacaaattgtagctacagtaggcaatatctgtatg
gatatgtgcatgttggatgtcacagatattgaagtcaacgaagaagatgaagttattgta
tatcctgatataaaagaggcagctttggccattgggaccataccgtatgaattgttggtc
aatatctcgcaacgggtgaaaagagtttatttttacgagtaa

DBGET integrated database retrieval system