KEGG   Sphingobacterium sp. ML3W: KO02_14380Help
Entry
KO02_14380        CDS       T03258                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sht  Sphingobacterium sp. ML3W
Pathway
sht00564  Glycerophospholipid metabolism
sht01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sht00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KO02_14380
Enzymes [BR:sht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KO02_14380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_3 Pyr_redox_2 GIDA NAD_binding_8 FAD_binding_3 partial_CstF Thi4 Lycopene_cycl 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIM37732
UniProt: A0A088F263
LinkDB All DBs
Position
3237821..3239392
Genome map
AA seq 523 aa AA seqDB search
MNFKRDKNLERVKKNSKWDVVIIGGGATGLGIAVDAASRGYKTLLLEKYDFAKATSSRST
KLVHGGVRYLANGDIKLVYSALRERGLIFKNAPHLAKVQSFIIPCYSFYSKWKYLIGLKI
YDWMAGSYRIGASKFLSNEQVVSKLTSIKKTGLKGGIIYYDGQFDDARFAINLAQTASML
DATILNYCDVNAIHKDENGHVSGISFTDLESEETIEITAKTVINATGIFVDDILKMESPT
HKNLVRPSQGTHIVIDKKFLGEDDALMIPETDDGRVLFGVPWHDHILLGTTDTPLDIHTI
EPRPLEEEVEFILSTAKTYLNPAPTRKDILSVFAGLRPLAAPKDENSKSTKEISRDHKLI
TSKSGLITITGGKWTTYRKMAEDTVNKAIEIGKLTDAPCITKTLKIHGYLEDKQEGHWQI
YGADADLIKDLAIKNPELNQKIHPKFDYIAAEVVWAVRNEMARRLEDVLARRMRMLFLDA
KAAMEAAPVVVHIMANELDQTESWEEEELQQFLALGKHYSYEA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
attaactttaaaagagacaaaaacctagaacgggtaaagaaaaactcgaaatgggatgtc
gtcatcattggggggggtgctaccggcctcggtattgctgttgatgccgcatcacgtgga
tataaaacactcctgttggaaaaatacgattttgcaaaagcgacctcgagcaggagtact
aaattggttcatggaggtgtccgctatttagcaaatggtgatataaagctcgtttattct
gctttaagagaaagaggattaatattcaaaaatgcacctcatctagctaaggtgcaaagt
tttattataccctgttattccttttatagtaaatggaagtatctgattggattaaaaatt
tacgattggatggcaggatcataccgcattggtgcgtccaaattcctatccaacgaacag
gtggtatccaaactaacatccatcaaaaaaacaggcctgaaaggtggaattatctactat
gatggacaatttgatgacgctagatttgctattaatttagcgcaaacagcaagcatgtta
gacgccacgatcctcaattattgcgatgtaaatgccatccataaagatgaaaatggacat
gtttctggcatctcatttacagatcttgaatcggaagaaacgattgaaataaccgcaaaa
acggtcatcaatgctactggtatttttgttgacgacattctcaaaatggagtctcctacc
cataagaacttagttagaccctcacaaggaacacatattgttatcgataaaaaattcttg
ggagaagatgatgccttaatgattccagagacagatgatggccgggttttgttcggtgtt
ccatggcatgaccacatcttattaggtacgacagataccccgctggatatccacaccatt
gaaccaagacctttggaggaagaggttgaatttatactctccactgctaaaacatacctc
aatccagcacctacgaggaaggatatactgagtgtttttgcaggtttaagaccattagct
gccccaaaagatgagaactccaaatcgacaaaagagatttcaagagaccacaaactgatt
acaagcaagtcaggattgattaccatcactggaggaaagtggactacctatcgaaaaatg
gcagaggatactgtaaataaggccattgaaatcggaaaattaaccgatgcaccttgcatc
actaaaaccctcaaaattcatggttatttagaagataaacaagaaggtcattggcaaatt
tacggtgctgatgctgacctgattaaagatttagcaattaaaaaccccgaactcaatcaa
aagatacatcccaagtttgattatatcgctgctgaagttgtatgggcggtaagaaatgaa
atggctaggcgactcgaggatgtcttagcaagaaggatgcggatgctgtttctagacgct
aaagctgctatggaggccgcacctgttgtagttcatattatggcgaatgaacttgatcag
acagaatcgtgggaagaagaagagcttcaacagttcttagcgcttggcaaacactacagt
tatgaggcataa

DBGET integrated database retrieval system