KEGG   Staphylococcus hyicus: SHYC_02460Help
Entry
SHYC_02460        CDS       T03578                                 

Gene name
cobA
Definition
(GenBank) uroporphyrin-III methyltransferase
  KO
K02303  uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
shu  Staphylococcus hyicus
Pathway
shu00860  Porphyrin and chlorophyll metabolism
shu01100  Metabolic pathways
shu01110  Biosynthesis of secondary metabolites
shu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SHYC_02460 (cobA)
Enzymes [BR:shu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     SHYC_02460 (cobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase
Motif
Other DBs
NCBI-ProteinID: AJC95296
LinkDB All DBs
Position
560022..560975
Genome map
AA seq 317 aa AA seqDB search
MSLIDAPQVYLVGAGPGNPLLLSKKAERCIQRADVILYDQLVNPFILQLSSPETEWIHVG
KTPYTTYMRQDEINALMIEKTKTHDTVVRLKGGDPAIFGRLADEVDILKNNHISFEVVPG
ITAASAAMSQLHRGLTERGVARNITFTTGHFKDNEENPIDMTTLKNDGTLAIYMGVKRLP
KLMKEVQSVITDDLPVAVIFNATCVNQQVISGHVSTITEKIAALPERPGPGITIVGKVVR
DILTEIPALAKVDYVCIKGARDKCMPQAMDIYERGGWAIIDDRATASIHPSQVEILTALI
DTTTFTQYLSESQPVRQ
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaatagatgcgccacaagtatatcttgtaggggcaggacccggtaatccgcta
ttattatcgaaaaaagcagagcggtgtattcaacgtgcagatgtgattctctatgatcaa
cttgtcaatccttttatcttacaactgtcttcgcctgaaacagagtggatacatgttggg
aaaaccccatacactacgtatatgcgacaagatgaaattaatgcgctaatgatagaaaaa
acgaaaacacacgatacggtggtacgcttaaaaggtggagaccccgctatattcgggcgt
cttgccgatgaggtcgatattttaaaaaataatcacatttcttttgaagttgtacctggt
attacagctgcaagtgctgcaatgagtcagctacatcgcggactgactgagcgtggagtg
gcacgaaatattacatttacaacggggcattttaaagacaatgaagaaaatccgattgat
atgacaacacttaaaaatgatggaacgcttgcaatttacatgggtgtgaaacgcttgcct
aagttaatgaaagaagtacaatcggtgattacagatgatttgccagtggctgttattttt
aatgcaacgtgtgtaaatcaacaagtgatttctggacatgtgtctacgattactgaaaaa
attgctgcattacctgaacgtccagggcctggcattactattgttggtaaagttgtcaga
gatatattgacagaaatcccagctttggcaaaagttgattatgtatgtattaaaggcgcg
cgtgacaaatgtatgccgcaagccatggatatttatgaaaggggcggatgggcgattatt
gatgatagagcaaccgcatcgattcacccatcacaagtcgaaatattaaccgcactcatt
gatacgactacgttcacacagtatttatctgagtcacagcccgtaagacagtga

DBGET integrated database retrieval system