KEGG   Staphylococcus hyicus: SHYC_03670Help
Entry
SHYC_03670        CDS       T03578                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
shu  Staphylococcus hyicus
Pathway
shu00280  Valine, leucine and isoleucine degradation
shu00310  Lysine degradation
shu00330  Arginine and proline metabolism
shu00340  Histidine metabolism
shu00380  Tryptophan metabolism
shu00561  Glycerolipid metabolism
shu00620  Pyruvate metabolism
shu00625  Chloroalkane and chloroalkene degradation
shu01100  Metabolic pathways
shu01110  Biosynthesis of secondary metabolites
shu01120  Microbial metabolism in diverse environments
shu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHYC_03670
   00053 Ascorbate and aldarate metabolism
    SHYC_03670
   00620 Pyruvate metabolism
    SHYC_03670
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SHYC_03670
   00561 Glycerolipid metabolism
    SHYC_03670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SHYC_03670
   00310 Lysine degradation
    SHYC_03670
   00330 Arginine and proline metabolism
    SHYC_03670
   00340 Histidine metabolism
    SHYC_03670
   00380 Tryptophan metabolism
    SHYC_03670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SHYC_03670
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SHYC_03670
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SHYC_03670
Enzymes [BR:shu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SHYC_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJC95529
UniProt: A0A0A8HRN5
LinkDB All DBs
Position
796777..798204
Genome map
AA seq 475 aa AA seqDB search
MRNQTKQYINGAWVDSHSGETIDVINPATEEVFGRIAKGDETDVNQAVKAAHDVYLEFRH
TPVKERQALLGRIVEEYKKRKNDLIEAMTLELGAPVTKSENVHYQMGLNHFQAAFDALDD
FQFEEQRGENLVVKEAIGVAGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAI
ILAEIFEAAGVPKGVFNLVNGDGEGVGNPLSEHPDVRMMSFTGSGGTGAKIMEKASKDFK
KVSLELGGKSPYIILDDADIEGAAQAAVNKVVNNTGQVCTAGTRTLIPESMKDDFLEKAK
AYMSNVKVGDPQSKDTDMGPIISKKQYDQVQDYIRKGIKEGATLYYGGTGLPEGLDKGYY
AKPTIFSDVDNKMTIAQEEIFGPVMSVITYKDIDEAIRIANDTKYGLAGYVYGQNKDTLQ
KVARSIEAGTVEINESGRTPDLPFGGYKQSGIGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaccaaacgaaacaatatataaatggtgcatgggtagacagtcatagtggtgaa
acaattgatgtcatcaacccagctaccgaagaagtatttggtcgcattgcaaaaggtgat
gaaacggacgtaaatcaagctgtgaaagcagcgcacgatgtctatttagaatttagacat
acgccagtaaaagagcgccaagctttacttggacgtatcgtcgaagaatataaaaaacgt
aaaaacgatttaatcgaagcaatgacacttgaattaggggcaccagtgactaaatctgaa
aatgtccattatcaaatggggcttaatcattttcaagcagcatttgacgcattggatgat
tttcaatttgaagagcaacgtggtgaaaatttagttgttaaagaagcaattggtgtggct
ggtttaattacaccttggaactttccaacgaaccaaacatcactgaaattagcagcggca
tttgctgctggttcaccagttgtattaaaaccatctgaagaaacaccatttgctgcaatt
attttagctgaaatttttgaagctgcaggagtacctaaaggtgtattcaatctcgtgaat
ggggacggtgaaggtgtaggtaatccattaagtgaacatcctgatgtgcgtatgatgtcc
tttacaggctcaggtggcactggtgcgaaaattatggaaaaagcaagtaaagatttcaag
aaagtatcgttagagttaggcgggaagtcaccttatatcattttagatgacgctgatatt
gaaggtgcagcacaggctgctgttaacaaagtagtgaataatactggtcaagtatgcact
gcgggtacccgtacgcttattccggaatcaatgaaagatgatttcttagaaaaagccaaa
gcatatatgtctaatgttaaagttggagatccgcaaagtaaagatacggatatgggccct
atcataagcaaaaaacaatatgatcaagttcaagactatattcgaaaagggatcaaagaa
ggcgcaaccctttattatggaggtacaggccttcctgaaggattagataaagggtactat
gctaaaccaacgatattctcagatgtggataacaaaatgacgattgctcaagaagaaata
ttcggaccagtcatgtctgttattacgtataaagatatcgatgaagcgattcgtatagct
aatgatacgaaatacggtctagcaggatatgtttacggtcaaaataaagacacattgcaa
aaagtagcacgctcaattgaagcaggtacagttgaaattaatgaatcaggcagaacacca
gatttaccattcgggggttacaaacagtcaggaatcggccgcgaatggggcgattatggt
attgaagaatttttagaagtgaaatcaatcgcaggatattttaaataa

DBGET integrated database retrieval system