KEGG   Staphylococcus hyicus: SHYC_08330Help
Entry
SHYC_08330        CDS       T03578                                 

Gene name
prkC
Definition
(GenBank) serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
shu  Staphylococcus hyicus
Brite
KEGG Orthology (KO) [BR:shu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shu01001]
    SHYC_08330 (prkC)
Enzymes [BR:shu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SHYC_08330 (prkC)
Protein kinases [BR:shu01001]
 Serine/threonine kinases: Other
  Bacterial family
   SHYC_08330 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Pkinase_fungal Kdo RIO1 Seadorna_VP7 ABC2_membrane_3 Kinase-like FTA2 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AJC96403
UniProt: A0A0A8HQJ8
LinkDB All DBs
Position
complement(1712452..1714431)
Genome map
AA seq 659 aa AA seqDB search
MIGRIIDERYELKHILGGGGMSNVYVAWDRILKRQVAVKMIHVPPNEKHETIARFEREVQ
NTTLLSHENIVSVLDVGEEDDCFFLVMEYIEGPTLSDYIKSHGQLAPEKAIKFANQIFKG
IHHAHEKGIIHRDIKPHNIIIDRNQTLKIVDFGIAKALSETAMTQTNHVVGTVQYLSPEQ
AKGEKTGARSDIYSLGIVLYEMLIGHPPFNGETPVSIAIKQIQDPVPNVSDTRHDVPQAL
SNVILKATEKDQSKRYTSVSEMRHDLSSTLSEARAHETLYHPNESATKTITLDKNAIKNE
SPQPKSVQQTTQIPVVTTAPHSTVSMKEGYQKRSKGKKILFGLIFMVLFFSLFIFVAAAM
MGDKYSQVPDVRGKKEVQAEKMLKDNKLKVGRISQDYSDDYAKNHIMKVKPEVGDKVEQG
TKVDLVVSKGEHIEDMPNLIGQSKADAVKTLEELGFKNVHFTTAYTQHDIAKGNIEGQSI
TPGKKVSVSKERVEITESLGKRQIYVDDYTNKKFSTVKKELENKGLTVNVESEREDDKIK
AGHIINHSPRKTEVDEGSTISFIVSKGEKSEDKDESSPDKTYSESFTIPYSGKGNKPQKV
EIFKKDKNSNGVSPIQSFNITKTMTQSLSFVIEEGGEASYMVKVDGKTIKDETIAYDDV
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgattggacgtattattgatgaacgttatgaactaaagcatattttaggcggcggcggt
atgagtaacgtctatgttgcttgggatcgtattttgaaacgccaagtagctgtgaagatg
atacatgttccgccaaatgaaaaacatgaaacaatagcgcgctttgaacgtgaagtacaa
aatacaacattattgtcccatgaaaatattgtaagtgtgttagatgttggtgaagaagat
gattgtttctttttagtgatggaatatattgaaggtcctacgctttctgattatattaaa
tctcatggacaattggccccagaaaaagcaattaaatttgcaaaccaaatttttaaaggc
attcatcatgcccatgaaaaagggattattcaccgagacattaagccacacaatatcatt
atagatcgtaatcaaacgcttaaaattgttgattttggtattgctaaggcgctgagtgag
actgcgatgacccaaacgaatcatgtcgtaggaacagttcaatatttatctcctgagcaa
gcaaaaggtgaaaaaacaggggcgcgttctgacatttattcgttagggattgtattatat
gaaatgcttatcggtcacccgccatttaatggtgaaacacctgtcagtatcgcaatcaaa
caaatacaagatccagttccaaatgtttctgatacgcgtcatgacgtgccgcaagcttta
agcaatgtgattttaaaggcaactgaaaaagatcagtctaaacgttatacatctgtttca
gaaatgcgtcatgatttaagttcgacattatctgaagcaagagcgcatgaaacactttac
catcctaacgaaagcgcaacaaaaacaattacgctagataaaaacgcgattaaaaatgaa
tctcctcaacctaaatcggttcagcaaacaactcaaatccctgttgttacgacagcacca
cattcgacggtatctatgaaagagggctatcaaaaacgttcaaaagggaagaaaatttta
tttggtctcatatttatggtgttatttttcagtttatttatctttgtcgctgcagcaatg
atgggagacaaatatagccaagtccctgatgtccgtggcaaaaaagaagtacaagctgaa
aaaatgcttaaagataataaattaaaagtagggcgtatttctcaagattatagtgatgat
tatgcaaaaaaccatattatgaaagtcaaacctgaagttggcgacaaggttgaacaaggg
acgaaagttgacctcgttgtgtctaaaggtgaacatattgaagatatgccaaacttaatt
ggccaatcaaaggctgatgctgtgaaaacgttagaagagttaggatttaaaaatgtacat
ttcaccacagcatacacgcaacatgatattgctaaagggaacatagaaggtcaaagtatc
acacctgggaaaaaagtgtctgtatctaaagaacgtgttgaaattacagagtctttaggt
aaacgtcaaatttacgtggatgattatacaaacaaaaagttttcgactgtgaaaaaagaa
ttagaaaataaaggattgacggtaaatgtcgagtccgaacgtgaagacgataagattaaa
gcgggtcacatcatcaatcattctccgcgtaagacagaagtagatgaaggcagtaccatt
agctttatcgtttcaaaaggtgaaaaatcagaggataaagacgaatcatcaccggataaa
acgtactcagaaagtttcacgattccttattcaggtaaaggaaataaaccacaaaaagtt
gagatttttaaaaaagataaaaatagcaatggtgtatctccaatacaatcatttaacatt
acaaagaccatgacacaaagtttgagtttcgttattgaagagggtggcgaggcaagctac
atggttaaagttgatggaaaaactataaaagatgaaaccatagcatacgatgatgtataa

DBGET integrated database retrieval system