KEGG   Staphylococcus hyicus: SHYC_09290Help
Entry
SHYC_09290        CDS       T03578                                 

Gene name
fabI
Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
shu  Staphylococcus hyicus
Pathway
shu00061  Fatty acid biosynthesis
shu00780  Biotin metabolism
shu01100  Metabolic pathways
shu01130  Biosynthesis of antibiotics
shu01212  Fatty acid metabolism
Module
shu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:shu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SHYC_09290 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SHYC_09290 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SHYC_09290 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:shu01004]
    SHYC_09290 (fabI)
Enzymes [BR:shu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SHYC_09290 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SHYC_09290 (fabI)
Lipid biosynthesis proteins [BR:shu01004]
 Fatty acid synthase
  Component type
   SHYC_09290 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AJC96590
UniProt: A0A0A8HSC7
LinkDB All DBs
Position
complement(1917077..1917847)
Genome map
AA seq 256 aa AA seqDB search
MMNLEGKTYVIMGIANKRSIGFGVAKVLDELGANLVFTYRKERSFNELDKLIDQLNQKEK
HVYQIDVQSDDDVEKGFEQIGKDVGNIDGVFHSIAFARVEELRGRYSETSRDGFLLAQDI
SSYSLTIVAREARKIMKDGGSIVTSSYIGGEFAVPNYNVMGIAKASLEASVKYLAADLGQ
DNIRVNCISAGPIKTLSSRGVGNFTTILKEIEQRAPLQRNVNQEEVGKTAAYLLSDFSSG
VTGENIHVDAGYHAIR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaatttagaaggaaaaacatatgtaataatggggattgccaataaaagaagtatt
ggttttggcgttgcgaaagtgttagacgaattaggagcaaatcttgtatttacataccgt
aaagaacgtagttttaatgaattagataagttgattgatcaattaaatcaaaaagaaaag
catgtgtatcaaattgatgtgcaaagtgatgacgatgttgaaaaaggttttgaacaaatc
ggcaaagatgtgggtaatattgatggtgttttccattctatcgcttttgcgcgtgttgaa
gaattacgtggccgttattctgaaacatctcgtgacggtttcttattggcacaagatatt
agttcatattcactaactattgttgcgcgtgaagcacgtaaaatcatgaaagatggcggt
agtatcgtgacatcttcatacatcggtggtgagttcgcggtaccaaactacaatgtgatg
gggattgcaaaagcaagtttagaagcaagtgtaaaatatttagcggctgatttaggtcaa
gataacattcgtgtcaactgcatttctgctggaccaatcaaaacattaagctcacgtggt
gtaggtaactttacaacaattttaaaagaaattgagcaacgtgcaccgttacaacgcaat
gtcaaccaagaagaagtgggtaaaacagcggcttatcttttaagtgatttttctagtggt
gtcacaggtgaaaatattcatgttgatgctggatatcatgcaattcgttaa

DBGET integrated database retrieval system