KEGG   Staphylococcus hyicus: SHYC_11175Help
Entry
SHYC_11175        CDS       T03578                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
shu  Staphylococcus hyicus
Pathway
shu00790  Folate biosynthesis
shu01100  Metabolic pathways
Module
shu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SHYC_11175 (folP)
Enzymes [BR:shu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SHYC_11175 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind ROQ_II
Motif
Other DBs
NCBI-ProteinID: AJC96944
LinkDB All DBs
Position
complement(2288909..2289700)
Genome map
AA seq 263 aa AA seqDB search
MKSTQIMGILNVTPDSFSDGGQYNDVEKAVAHAHQMVEAGAHIIDVGGVSTRPGHEEVTV
EEELQRVVPVVKALNGIGAQISVDTFRSEVAEVALEAGAHIINDQWAGLYDEALFEVVAK
YHAEIILMHNGDGKRDTPVVDEMLVTLLKQANKAMLAGIPKEKIWLDPGIGFAKTRQEEQ
IVMARLDELVATGFKVLLATSRKRFIKELLGGGNKVDERDEATAATTAYGIMKGVDGVRV
HNVLMNARLARAMDALKGYENER
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctacacaaatcatgggtattttaaatgtgacacctgattcattttcagacggc
ggtcagtataatgatgttgaaaaagcagtcgcacatgcacatcaaatggttgaagcaggt
gcgcatatcattgatgttggtggtgtatcgacgcggccaggacatgaagaagttacggtc
gaagaagaattacaacgtgtggtgcctgttgttaaggctttaaatggcattggtgcgcaa
atatccgtagatacatttagaagtgaagttgctgaagtggctcttgaagcgggtgcgcac
atcattaatgaccaatgggcgggtttatatgatgaagcgttatttgaggttgtcgccaaa
tatcacgctgagattattttaatgcacaatggtgatgggaaaagagacacacctgtcgtg
gatgaaatgttagttactttgttaaaacaagcaaacaaagcgatgttagcgggtattcca
aaagaaaagatatggcttgaccccggcattggctttgccaaaacacgtcaagaagaacaa
attgtgatggcacgactagatgaactggttgccacaggttttaaagtacttctcgcaacg
agtcgcaaacgttttataaaagaattgttaggcggggggaataaagtggatgaacgtgat
gaggcgactgcggcaaccaccgcgtatggtattatgaaaggagtcgatggtgtgcgtgtg
cataacgtattaatgaatgcgcgtctagcaagagcgatggatgcgttgaaaggatatgaa
aatgaacgataa

DBGET integrated database retrieval system