KEGG   Staphylococcus hyicus: SHYC_11830Help
Entry
SHYC_11830        CDS       T03578                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shu  Staphylococcus hyicus
Brite
KEGG Orthology (KO) [BR:shu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SHYC_11830 (ahpF)
Enzymes [BR:shu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SHYC_11830 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_binding_2 FAD_oxidored DAO Thi4 NAD_binding_8 AlaDh_PNT_C FAD_binding_3 K_oxygenase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AJC97067
LinkDB All DBs
Position
2429903..2431426
Genome map
AA seq 507 aa AA seqDB search
MLNQELKQQLTQLLDLMEGDVVFKLSAGTDEHSQKLSDLVNEVADMSSHITVEKADLKRT
PSFSINRPNEESGITFSGVPLGHEFNSFVLALLQVSGRAPKESQSVIDQIKAIDKPLNFE
TFVSLTCQKCPDVVQALNLMSVLNPNITHTMIDGAVFKKEAEDIMAVPATFLNGESFGNG
RMTVSDILNELGEGPDASEFEGKETFDVLVIGGGPASASAAIYAARKGLKTGIVADRIGG
QVNDTADIENLIGVKKTTGPELSSNLEQHISDYKVDIMKGVRADKIQKTDEGTDVTLNNG
ATLKTKSLIIATGARWRQLGVPGESEFANKGVAYCPHCDGPLFEGKDVAVVGGGNSGVEA
AIDLAGICKHVTLFEFGEEMRADSVLQERLRSLPNTTVITNAATSEITGTDRVNGITYTD
RATDESKHVELDGVFVQIGLSPNTEWVGDAVQRNRMGEIEVDRLNQTSVPGIFAAGDCTD
QRYKQIIISMGSGASAALSAFDYLIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaccaagagttaaagcaacaacttacacagctccttgatttaatggaaggtgac
gtggtgttcaaattaagtgctggcactgatgaacattcacaaaaattaagcgacttagta
aacgaagttgcagacatgtcatctcacattactgttgaaaaagctgatttaaaacgcaca
ccaagttttagtattaaccgaccaaatgaggaatcaggtatcactttttcaggagttcct
ttaggtcacgagtttaattcatttgtgctcgctttactacaagtcagtggtcgcgcacca
aaagaatcacaatctgtgatcgatcaaatcaaagcaatagacaaaccattaaattttgaa
acgtttgtcagcttgacatgtcaaaaatgtcctgatgtcgttcaagcattaaacttaatg
tcagtcctcaatccaaatattacacatacgatgattgacggcgccgtattcaaaaaagaa
gctgaagacatcatggctgtgcctgccaccttcttaaatggggaatcatttggtaatggc
cgtatgaccgtttcagatattttaaacgaattaggcgaaggtcctgatgcgtctgaattt
gaaggcaaagaaacattcgacgttcttgtcatcggtggcggtcctgcaagcgcaagtgca
gcgatttatgctgcccgtaaaggtttaaaaacaggtattgtcgctgaccgtattggtggt
caggtgaatgatacggctgatatcgaaaacttaatcggcgtgaaaaagacaactggtcct
gaactatcatcaaaccttgaacaacacatttcagactacaaagtagacatcatgaaaggt
gttcgtgctgataagattcaaaaaacggacgaaggcacagacgttacgttaaataacggt
gcaacgttaaaaacaaaatcattaatcatcgctacaggcgcgcgttggcgtcaacttggc
gtacctggtgaaagcgaatttgccaacaaaggtgtcgcatactgcccacactgtgatggc
ccattatttgaaggtaaggatgtcgctgttgtcggtggtggtaactctggggtagaagct
gccattgaccttgcaggtatttgtaaacacgtgacattgtttgaattcggtgaagaaatg
cgtgcagactctgttttacaagaacgtcttcgctcattaccgaacacgacagtaatcact
aatgctgcaacttctgaaattacaggtacagatcgtgttaatgggattacgtatacagat
cgtgcaactgacgaatctaaacacgttgaattagatggtgtgtttgttcaaatcggttta
tccccaaatacagagtgggttggcgatgccgttcaacgcaaccgtatgggtgaaatcgaa
gtagacagattgaatcaaacaagcgtccctggcattttcgcagcgggagactgtacagat
caacgctacaaacaaattattatttcaatgggatctggtgcaagcgcagcattatctgca
tttgattacctcatccgtaattaa

DBGET integrated database retrieval system