KEGG   Stella humosa: STHU_16050Help
Entry
STHU_16050        CDS       T06078                                 

Gene name
oppD
Definition
(GenBank) oligopeptide ABC transporter ATP-binding protein OppF
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
shum  Stella humosa
Pathway
shum02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:shum00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    STHU_16050 (oppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shum02000]
    STHU_16050 (oppD)
Transporters [BR:shum02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    STHU_16050 (oppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_16 AAA_22 AAA AAA_29 AAA_25 ATP-synt_ab NB-ARC TniB RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BBK30971
LinkDB All DBs
Position
1702630..1704675
Genome map
AA seq 681 aa AA seqDB search
MPSATLLEPTQARAGDAVPLISVEDLRVEFATGRGVVKAVDGVSWSVRPGETMALVGESG
CGKSVSALAVMRLLAKPAGRVAGGRIMFDGRDLLTLQESEMRELRGRDISMIFQEPMTSL
NPILTIGLQIMEPLKIHLGMSDEQATARAVELLGLVGIPDAARRLGQFPHQFSGGMRQRV
MIAIGLACNPKLIIADEPTTALDVTIQAQILELMKDLSRRLGITLVIITHNLGIVARYAD
RVAVMYAGRVVEEGPADRVFGAPRHPYTIGLMRSVPRLDRPRDYKLATIEGLPPNLLSPP
SGCRFAARCPFRIEKCAIDPPYHDAGDGQRSACHRAEELAQGLAEATVAPLAEPLGRADT
GPLLEVRGLTKHFEVRGRGLLGAKGLVRAVENVSFSIERGRTLGLVGESGCGKTTIGRTI
LRLEDATGGEVRFDGEDLVGASRSRMKELRTKIQVIFQDPYSSLNPRMSIGDIIAEPLVF
RRSVPRRQAREQVAELLVQVGLYADMAERFPHQLSGGQRQRVGIARALAMDPSFIVCDEP
VSALDVSIQGQIINLLDELQERLGLTYLFIAHDLAVVRHISHRIVVMYLGRVMEMADRDE
LYAAPLHPYTQALLDAAPVPDPVAERARQPRALTGELPSPLAPPSGCVFHTRCPLATAEC
RQAVPEVREVRPGHFAACIKI
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcgccactcttctggagccgacgcaagccagggccggcgatgccgtgccactg
atttccgtggaagacctgcgggtcgaattcgccaccggccgcggggtcgtgaaagccgtc
gacggcgtaagctggtccgtccggccgggcgagacgatggcgctggtcggcgaatccggc
tgcggcaagtcggtgtcggcgctggcggtcatgcggctgctggccaagccggccggccgc
gtcgccggcgggcgcatcatgttcgacggccgcgacctgctgaccttgcaggaaagcgag
atgcgcgagctgcgtggccgcgacatctcgatgatcttccaggaacccatgaccagcctg
aacccgatcctgacgatcgggctgcagatcatggagccgctgaagatccatctcggcatg
tcggacgagcaggcgacggcgcgcgcggtcgagctgctggggctggtcggcattcccgac
gcggcccgccggctcggccagttcccgcaccagttctcgggcggcatgcgccagcgcgtg
atgatcgccatcgggctggcctgcaatcccaagctgatcatcgccgacgagccgacgacg
gcgctcgacgtcaccatccaggcccagatcctggagctgatgaaggacctgtcgcggcgc
ctcggcatcacgctcgtcatcatcacccacaatctcggcatcgtcgcgcgctatgccgac
cgggtggcggtcatgtatgccggccgggtggtggaggaggggccggccgaccgggtcttc
ggcgctccgcgccacccctacacgatcggcctgatgcgctcggtcccccggctcgaccgg
ccgcgcgactacaagctggcgacgatcgaggggttgccgcccaacctgctgtcgccgccc
agcggctgccgctttgccgcccgctgcccgttccgcatcgagaagtgcgcgatcgacccg
ccctaccacgatgccggcgacggccagcgctcggcctgccaccgcgccgaggaactggcg
cagggcttggccgaggcgaccgtagccccgctggccgaaccgctcggccgggccgacacc
gggccgctgctggaagtccgcgggctgaccaagcatttcgaggtgcgtggccgcggcctg
ctgggggccaagggactggtccgcgcggtcgagaacgtgtccttttcgatcgagcgcggg
cggaccctgggcctcgtcggcgaatccggctgcggcaagaccaccatcggccgcaccatc
ctccggctggaggacgccacgggcggcgaggtccgcttcgacggcgaggacctggtcggc
gcctcgcgttcgcgcatgaaggagctgcggaccaagatccaggtcatcttccaggacccc
tacagctcgctcaacccgcgcatgtcgatcggcgacatcatcgccgagccgctggtcttc
cgccgcagcgtgccgcgtcgccaggcgcgcgagcaggtggccgagcttctggtgcaggtc
ggtctctatgccgacatggccgagcgcttcccccatcagctttcgggcgggcagcgccag
cgcgtcggcattgctcgggcactggccatggaccccagcttcatcgtctgcgacgagccg
gtgtcggcgctggacgtgtcgatccagggccagatcatcaacctgctggacgaactgcag
gagcggctgggcctgacctatctcttcatcgcccatgacctggcggtggtgcgccacatc
tcgcaccgcatcgtcgtcatgtatctgggtcgggtgatggagatggccgaccgcgacgag
ctctatgccgctcccctccatccctacacccaggcgctgctcgacgcggccccggtgccc
gatccggtggccgagcgcgcccgccagccgcgcgcgctgaccggcgagctgccgtcgccg
ctggcgccgccgtcgggttgcgtgttccacacgcgctgtccgctggcgacggcggaatgc
cgacaggcggtgccggaggtgcgcgaggtgcgccccgggcatttcgccgcctgcatcaag
atctga

DBGET integrated database retrieval system