KEGG   Stella humosa: STHU_31800Help
Entry
STHU_31800        CDS       T06078                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
shum  Stella humosa
Pathway
shum02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:shum00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    STHU_31800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shum02000]
    STHU_31800
Transporters [BR:shum02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    STHU_31800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N TniB ABC_ATPase ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: BBK32546
LinkDB All DBs
Position
3365219..3366205
Genome map
AA seq 328 aa AA seqDB search
MAEAPLLDVRDLKTYFKTEGGLFRAVDGISFQVRRGRTLGIVGESGCGKSVTSLSIMGLV
PQPPGIRAGGEILFEGEDLLKKRPAELRRIRGGAISMIFQEPMTSLNPVFTVGDQIAEAI
TAHLPMSAAAARERAIAMLRRVRIPSPERRVDDYPHLMSGGMRQRVMIAMALACDPKLLI
ADEPTTALDVTIQAQILDLMRTLRDETGTSIILITHDLGVIAEIADEVVVMYAGKIVESA
SVKSLFADPQHPYTIGLMGSIPKLEEERTRLASIEGTVPAPFALPEGCRFNPRCPFADDR
CRREEPPLRTLRDGHAVACWKAPLEEAA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcgccgcttctcgacgtccgcgacctcaagacctacttcaagaccgagggc
ggcctgttccgggccgtcgacggcatctcgttccaggtgcggcgcgggcgcacgctcggc
atcgtcggcgaatcgggctgcggcaagagcgtcacctcgctgtccatcatggggctggtg
ccgcagccgcctggcatccgcgccggcggcgagatcctgttcgagggcgaggacctgctg
aagaagcggccggccgagctgcgccgcatccgcggcggggccatctcgatgatcttccag
gagccgatgacgtcgctgaacccggtctttacggtcggcgaccagatcgccgaggcgatc
acggcacacctgccgatgagtgcggcggccgcccgcgagcgcgccatcgccatgctgcgt
cgggtgcgcatcccctcgcccgagcgccgggtcgacgactacccgcacctgatgtcgggc
ggcatgcgccagcgggtgatgatcgccatggcgctcgcctgcgaccccaagctgctgatc
gccgacgagccgacgacggcgctcgacgtcaccatccaggcgcagatcctcgacctgatg
cgcacgctgcgcgacgagaccggcacctcgatcatcctcatcacccacgacctgggcgtc
atcgccgagatcgccgacgaggtggtggtgatgtatgccggcaagatcgtcgagagcgcc
tcggtcaagtcgctcttcgccgacccgcagcacccctacacgatcggcctgatgggctcg
atccccaagctggaggaggagcgcacgcggctggcctcgatcgagggcacggtgccggct
ccgttcgccctgcccgagggctgccgcttcaacccgcgctgcccctttgccgacgatcgc
tgccggcgcgaggaaccgcccttgcgcaccctgcgcgacgggcacgccgtcgcctgctgg
aaggcaccgctcgaggaggccgcgtga

DBGET integrated database retrieval system