KEGG   Stella humosa: STHU_54510Help
Entry
STHU_54510        CDS       T06078                                 

Gene name
pstB
Definition
(GenBank) phosphate import ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
shum  Stella humosa
Pathway
shum02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:shum00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STHU_54510 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shum02000]
    STHU_54510 (pstB)
Enzymes [BR:shum01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     STHU_54510 (pstB)
Transporters [BR:shum02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    STHU_54510 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 AAA_22 RsgA_GTPase AAA_30 ABC_ATPase Adeno_IVa2 AAA_18 AAA_28 AAA_15 AAA_33 Rad17 AAA_25 ATPase_2 AAA_23 AAA_5 AAA NB-ARC NACHT AAA_24 RNA_helicase MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: BBK34817
LinkDB All DBs
Position
5723641..5724474
Genome map
AA seq 277 aa AA seqDB search
MVALAADDVRPSVTETETVYHLKRGPEGTALAIEDFRLWYGAAQALHGVSMTVERGLVTA
LIGPSGCGKSTLLRSLNRMNDLIDGLRTGGRVMFDGTDIYDRRVDVIALRKRMGMVFQKP
NPFPMSIFENVIYPLRVDGIRDRHVLEETVERALKGSALWDEVKDRLHQSALGMSGGQQQ
RLCIARAIAADPEVLLMDEPCSALDPIATAKIEELIDDLSGRYTIIIVTHNMQQAARVSD
NTAFMYLGRLIEYGETEAMFTNPKLGRTRDYVTGRFG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgctcgccgcagacgatgtccgtcccagcgtgacggagaccgagaccgtctat
cacctgaagcgcgggcccgagggcacggcgctcgcgatcgaggacttccgcctgtggtac
ggggccgcccaggccctccacggcgtgtcgatgacggtcgagcgcggcctggtcaccgcc
ctgatcggcccgtccggctgcggcaagtcgaccctgctgcgctcgctcaaccgcatgaac
gacctgatcgacgggctgcgcaccggcggccgggtgatgttcgacggcaccgacatctac
gatcgccgggtcgacgtcatcgcgctgcgcaagcgtatgggcatggtgttccagaagccg
aaccccttccccatgtcgatcttcgagaacgtcatataccccctgcgggtggacggcatc
cgcgaccgccacgtgctggaggagacggtcgagcgcgcgctgaagggctcggccctgtgg
gacgaggtgaaggaccggctgcaccagagcgcgctcggcatgtcgggcggccagcagcag
cgcctgtgcatcgcgcgcgcgatcgcggccgatcccgaggtgctgctgatggacgagccc
tgctcggcgctggacccgatcgcgaccgccaagatcgaggagctgatcgacgatctgtcg
ggccgctacaccatcatcatcgtcacccacaacatgcagcaggcggcccgcgtgtccgac
aacaccgccttcatgtatctgggccggctgatcgagtacggcgagaccgaggccatgttc
acgaacccgaagctgggccgcacgcgcgactatgtgaccggccggttcggctga

DBGET integrated database retrieval system