KEGG   Stella humosa: STHU_55550Help
Entry
STHU_55550        CDS       T06078                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
shum  Stella humosa
Pathway
shum00071  Fatty acid degradation
shum00280  Valine, leucine and isoleucine degradation
shum00281  Geraniol degradation
shum00310  Lysine degradation
shum00360  Phenylalanine metabolism
shum00362  Benzoate degradation
shum00380  Tryptophan metabolism
shum00410  beta-Alanine metabolism
shum00627  Aminobenzoate degradation
shum00640  Propanoate metabolism
shum00650  Butanoate metabolism
shum00903  Limonene and pinene degradation
shum00930  Caprolactam degradation
shum01100  Metabolic pathways
shum01110  Biosynthesis of secondary metabolites
shum01120  Microbial metabolism in diverse environments
shum01130  Biosynthesis of antibiotics
shum01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:shum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STHU_55550
   00650 Butanoate metabolism
    STHU_55550
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STHU_55550
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STHU_55550
   00310 Lysine degradation
    STHU_55550
   00360 Phenylalanine metabolism
    STHU_55550
   00380 Tryptophan metabolism
    STHU_55550
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STHU_55550
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STHU_55550
   00281 Geraniol degradation
    STHU_55550
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STHU_55550
   00627 Aminobenzoate degradation
    STHU_55550
   00930 Caprolactam degradation
    STHU_55550
Enzymes [BR:shum01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STHU_55550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: BBK34921
LinkDB All DBs
Position
5830759..5831535
Genome map
AA seq 258 aa AA seqDB search
MAYETVLVETRGKVGIVTLNRPKALNALSAELVRELGQALDAFEADSAIGAIVLTGSEKA
FAAGADIKEMATKGYMDVYLADFITSGWERVTTCRKPIVAAVAGYALGGGCEVAMMCDFI
LAADTAKFGQPEITIGTIPGAGGTQRLTRAVGKAKAMEMVLTGRMMDAAEAERSGLVSRV
VPAADLLAEAVKAAEKMAGLSLPVVMLAKEAVNRAFETTLAEGVRFERRLFHSTFATEDQ
KEGMAAFVEKRPPAFRNR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgagacggtcctcgtcgaaacgcggggcaaggtcggcatcgtcaccctcaac
cggcccaaggccctgaacgcgctgtcggccgagctcgtccgcgagctgggccaggcgctg
gatgccttcgaggccgactccgccatcggcgccatcgtcctgaccggcagcgagaaggcg
ttcgccgccggcgccgatatcaaggagatggcgaccaagggctacatggatgtctatctc
gccgacttcatcaccagcggctgggagcgcgtgaccacctgtcgcaagccgatcgtggcc
gcggtcgcgggctatgcgctgggcgggggctgcgaggtggcgatgatgtgcgacttcatc
ctggccgccgataccgcgaagttcggccagccggagatcaccatcggcacgattcccggc
gccggcggcacccagcgcctgacgcgcgcggtgggcaaggccaaggcgatggagatggtg
ctgacgggccgcatgatggacgcggccgaggccgagcggtcggggctggtgtcgcgcgtc
gtgccggcggccgacctgctggccgaggcggtgaaggcggccgagaagatggccggcctg
tcgctgcccgtggtcatgctggccaaggaggcggtgaaccgcgccttcgagaccaccctg
gccgagggcgtgcggttcgagcggcgcctgttccactccaccttcgcgaccgaggaccag
aaggaaggcatggccgccttcgtcgagaagcgcccgcccgccttccgcaatcgctag

DBGET integrated database retrieval system