KEGG   Salinicoccus halodurans: AAT16_00740Help
Entry
AAT16_00740       CDS       T03940                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
shv  Salinicoccus halodurans
Pathway
shv00010  Glycolysis / Gluconeogenesis
shv00071  Fatty acid degradation
shv00280  Valine, leucine and isoleucine degradation
shv00310  Lysine degradation
shv00330  Arginine and proline metabolism
shv00340  Histidine metabolism
shv00380  Tryptophan metabolism
shv00410  beta-Alanine metabolism
shv00561  Glycerolipid metabolism
shv00620  Pyruvate metabolism
shv00625  Chloroalkane and chloroalkene degradation
shv01100  Metabolic pathways
shv01110  Biosynthesis of secondary metabolites
shv01120  Microbial metabolism in diverse environments
shv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAT16_00740
   00053 Ascorbate and aldarate metabolism
    AAT16_00740
   00620 Pyruvate metabolism
    AAT16_00740
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AAT16_00740
   00561 Glycerolipid metabolism
    AAT16_00740
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAT16_00740
   00310 Lysine degradation
    AAT16_00740
   00330 Arginine and proline metabolism
    AAT16_00740
   00340 Histidine metabolism
    AAT16_00740
   00380 Tryptophan metabolism
    AAT16_00740
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AAT16_00740
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AAT16_00740
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AAT16_00740
Enzymes [BR:shv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AAT16_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AKG72875
UniProt: A0A0F7D3Q1
LinkDB All DBs
Position
complement(152694..154121)
Genome map
AA seq 475 aa AA seqDB search
MKDHIKQYINGEWVDSASGETIDVINPSTGEAFGRIAKGNAEDVDKAVEAAHNVYIEFRN
TPAEERRAMLDRIVTEYENRKNDLIEAITDELGSPIDKSEKVHYQMGLNHFAAARDALDS
FQFEEQRGENLVVKEAIGVAGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKADVPKGVFNLVNGDGEGVGNPLSEHPKVRMMSFTGSGRTGSKIMEKASVDFK
KVSLELGGKSPLIILDDADVDKAAFTAVQKVVNNTGQVCTAGTRTLIPESMKDEFLEKVK
EKMNQVKVGNPREDGVEMGPLISKKQYDTVQSYINKGVEEGATLYHGGPDQPEGQDKGFY
VKPTVFSDVDNKMTIAQEEIFGPVMSVITYKNLDDAIELANDTKYGLAGYVYGEDMETLQ
KVARSIEAGTVEINNAKGAANLPFGGYKQSGIGREWGDFGIEEFLEVKSIKGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcatattaagcaatatataaatggtgaatgggttgacagtgcaagcggcgag
acgattgatgtcataaatccttctaccggtgaagcttttggcagaattgccaaagggaat
gccgaagatgtggataaagccgtggaagctgcccataacgtttatatagagtttcgtaat
acacctgcagaagaacgccgcgcaatgcttgacaggattgtcactgaatacgaaaatcgt
aagaatgatctgattgaagcaattaccgacgaactcggttctccaatagataaatctgaa
aaagtgcattaccagatgggattgaatcattttgctgctgcgcgtgatgctctggattct
ttccagttcgaagaacagcgcggtgaaaacctggtggtcaaagaagccatcggcgttgcg
gggctgatcacgccctggaattttcctaccaaccagacgtccctcaaacttgcagctgca
tttgccgcagggagtccggtagtactgaaaccttctgaagagacaccgttcgccgcagtg
attctggctgaaatcttcgataaggccgatgtgccaaaaggtgttttcaacctggttaac
ggtgacggtgaaggcgtagggaacccgctcagtgaacatcctaaagtacgcatgatgtca
tttaccggatccggcagaaccggctccaaaatcatggagaaagcaagtgtggatttcaaa
aaggtctcccttgaactcggtggtaaatcccctctgatcatcctggatgatgcggatgtg
gataaagcagcctttacagctgttcagaaagtagtgaacaataccggacaggtttgtact
gcaggcacacgcacgctgattcctgaatccatgaaggatgaattccttgagaaagtaaaa
gaaaaaatgaatcaggtcaaagtggggaatccaagagaagatggtgtcgaaatgggtcct
ctcatcagcaaaaaacaatatgatacagtccaatcctatatcaataaaggcgtagaagag
ggtgcaacactttatcacggcggaccggatcagcccgaaggccaggacaaaggcttctat
gtcaaaccgactgtgttcagtgatgttgataataagatgacgattgcacaggaagaaatt
ttcggaccggtgatgtccgtaatcacctacaaaaatctggatgacgcgattgaacttgcg
aatgatacgaaatacggtcttgcaggctatgtctatggtgaagatatggaaaccttacag
aaagtagcccgttccattgaagccggtactgtcgaaatcaataacgcaaaaggggctgcc
aatctgccattcggaggttataaacaatcaggcatcggacgcgaatggggagatttcggt
atcgaagaattcctggaagtgaaatccatcaaaggttattttaaataa

DBGET integrated database retrieval system