KEGG   Salinicoccus halodurans: AAT16_02445Help
Entry
AAT16_02445       CDS       T03940                                 

Definition
(GenBank) hypothetical protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
shv  Salinicoccus halodurans
Pathway
shv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:shv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AAT16_02445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shv02000]
    AAT16_02445
Transporters [BR:shv02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AAT16_02445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran RsgA_GTPase ABC_membrane SMC_N AAA_29 AAA_22 cobW MMR_HSR1 NACHT MobB Roc AAA_28 FtsK_SpoIIIE ATPase_2 Pox_P21 DUF87
Motif
Other DBs
NCBI-ProteinID: AKG73175
UniProt: A0A0F7D3W1
LinkDB All DBs
Position
472392..474011
Genome map
AA seq 539 aa AA seqDB search
MEYLKSERKQIFYSILLGLAGGLVGVALFGLSGYMISLSFFEPPFFIIILIIAVIKLFGM
MKGAFRYIERLLSHEATFQMIGRLRLNYFTKSLAMDEDTHSVKFIQKLNQHFDRVEDYYI
RIIYPYVTAALLTLILLLLAFYINTEVVLIMAAASLLLLFAIPKLFEGLSYKEAEKREET
DDAFYMKLYHYIHDYTDLFVRRQTETHKKGLYGYLAGIKRHEDKKALYESLMGFAANLIQ
IAMIILVIFVMYQETPMLVPMVMLLGLSYFDQVVPVIQPASNYRTVKDAVRELDTAEVER
EDEAETDKNIEKIIIEDLAYKYPGSNTNVLKNIEVAFTAGEKHAIIGSSGSGKTTLLNRI
IEGDDAVNFYGNSEKAGHDTLINDASVMPQHLDFYNATIEANITMFGHLKTSAECMKNHL
AEMEMSYYTPDTMITHTGRLSGGEQKRLHFIRMMIEDKQWWVMDEPTARLDEKLREKIWN
HVLDRETAIVSTHDLSRLDAFDRISYMEQGEIIESGSYDDLMNEKGAVYHAVLRYADNL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttgaaaagtgaaaggaagcagatattttacagtatactcctcgggctggcc
ggcgggctcgtcggtgttgcactgtttgggctgagtggctatatgatcagcctgagtttc
ttcgaaccgccgtttttcatcatcatcctgatcattgcagtcatcaaattgttcggtatg
atgaaaggtgctttccgttatattgagcggcttctgtcacatgaagcgacatttcagatg
atcggaagactcagactgaattacttcacaaaatcgctggccatggatgaagatacccac
agcgtcaagttcatccagaaactgaaccagcatttcgaccgtgtggaggactactatata
aggatcatctacccatatgttacagctgcgctgctgacattgatacttttactgctggca
ttttatatcaacacagaagtggtactcataatggcagcagcatcactgctgctccttttc
gcaattccaaagctttttgaagggctgtcatacaaagaagctgaaaaaagggaagagacg
gacgatgctttctatatgaaactctatcattacatccatgactatactgatttgttcgtg
cgcagacagacagaaacacataaaaaaggattgtatggatatctggccggcatcaaaagg
catgaagataaaaaggcattgtatgagagtctgatgggctttgcagcgaacctcatccag
attgccatgatcatacttgtgatttttgtaatgtatcaggaaacaccaatgcttgttccg
atggtcatgcttctcgggctcagctacttcgaccaggtggtgcctgtaattcagcctgcg
agcaattaccggacggtaaaagatgcagtccgggagctcgatacagcagaagtggaaagg
gaagatgaagcggagacagataaaaatatagaaaagataataatagaagatctggcttac
aaatatccgggctcaaacacgaatgtattgaaaaatatcgaggtggctttcacagcgggt
gagaagcacgcaatcatcggcagcagcggatcgggtaaaacgacattgctgaaccgcatt
atagaaggcgatgatgcggtaaacttttacggcaatagtgaaaaggcggggcatgatacg
ctcatcaatgatgcatccgtaatgccccagcaccttgatttctacaatgcaacgatcgag
gcgaatatcacgatgttcggtcatctgaaaacatcggcggagtgcatgaaaaatcatctg
gcagagatggagatgtcctattacacgccggacacgatgatcacccatacaggcagactt
tcaggcggggagcagaaaaggctccacttcatccgcatgatgattgaagataagcagtgg
tgggtaatggatgaaccgacagcacggctggatgagaagctccgggagaaaatctggaat
catgtgctggaccgcgaaacagccattgtcagcacccatgacctcagcaggctggatgcg
ttcgaccggatttcttatatggagcagggtgagataatagaatccggaagttatgacgat
ctgatgaacgaaaaaggggcggtatatcatgccgtcctgcgctacgctgataatttatag

DBGET integrated database retrieval system