KEGG   Salinicoccus halodurans: AAT16_03485Help
Entry
AAT16_03485       CDS       T03940                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
shv  Salinicoccus halodurans
Pathway
shv00061  Fatty acid biosynthesis
shv00780  Biotin metabolism
shv01100  Metabolic pathways
shv01130  Biosynthesis of antibiotics
shv01212  Fatty acid metabolism
Module
shv_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:shv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AAT16_03485
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AAT16_03485
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AAT16_03485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:shv01004]
    AAT16_03485
Enzymes [BR:shv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AAT16_03485
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AAT16_03485
Lipid biosynthesis proteins [BR:shv01004]
 Fatty acid synthase
  Component type
   AAT16_03485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Oxidored_nitro Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AKG73362
UniProt: A0A0F7HJV7
LinkDB All DBs
Position
684099..684866
Genome map
AA seq 255 aa AA seqDB search
MNLEGKTYVIMGVANKRSIAWGAARALDQMGAKLVFTILNERFRRELEKLLGELEGDHDI
VVECDVQDDAQIESAFREIGEKTGGIDGLLHAIAFAGKDELKGGYSETTREGFKNALDIS
TYSLTVVAKHAKKIMNEGGSIVTMTYLGGERAMPNYNVMGVAKAALDSSVRYLAYDLGED
GFRVNAVSAGPIRTLSSSAVGEFKSILKEIEEKAPLRRNVDQLEVGNTVAFLLSDLASGI
TGEVVHVDSGYHIMA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgaaggtaaaacctatgtcatcatgggtgtcgcaaataagcgcagtatcgcc
tggggtgcagcacgtgcgctcgaccagatgggagcgaaactcgttttcacaattctgaac
gagcgtttccgccgtgagctggaaaagcttctgggtgagcttgaaggcgatcatgatatc
gttgttgaatgtgatgttcaggacgatgcgcagatcgagtctgctttcagggaaatcggt
gagaagaccggtggcatcgatggtctgcttcacgcaatcgcattcgcgggcaaggacgag
cttaaaggcggctacagcgaaacgacgcgtgaaggattcaaaaatgcactggatatcagc
acatactcgctgactgttgttgcgaaacatgcgaagaaaatcatgaatgagggcggcagc
atcgttacgatgacgtacctcggcggcgagcgcgctatgccgaactacaacgtgatgggt
gtggcgaaagcggccctcgactcaagcgtacgctacctagcatacgatctcggcgaagac
gggttccgtgtcaacgcagtatccgcaggcccgattcgtaccctcagctcatctgctgta
ggcgaattcaaatcaatcttgaaagaaatcgaagaaaaagcacctctccgcagaaacgtg
gatcagcttgaagtcggaaacacagtggcattcctgctcagcgatctcgcaagcggaatc
acaggcgaagtcgttcacgtcgactccggctaccatataatggcgtag

DBGET integrated database retrieval system