KEGG   Salinicoccus halodurans: AAT16_04275
Entry
AAT16_04275       CDS       T03940                                 

Definition
(GenBank) iditol 2-dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
shv  Salinicoccus halodurans
Brite
KEGG Orthology (KO) [BR:shv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AAT16_04275
Enzymes [BR:shv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     AAT16_04275
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C PALP TrkA_N F420_oxidored ADH_zinc_N_2 ThiF
Other DBs
NCBI-ProteinID: AKG73498
UniProt: A0A0F7HKA1
LinkDB
Position
861962..863068
AA seq 368 aa
MNETVETKEANSTVPEKMKAVVAYAPKDYRYEEVSTPEIENDKEIIIKLEACGICAGDIK
AYDGAPSFWGDETQPAYIKAPMIPGHEFIGHIVQKGDAVTDFEIGDRVISEQIVPCWDCR
FCNRGQYWMCEKHDLYGFQKNVNGGMAEYMKFTKEAINFKVPEELPIEQAILIEPYACSL
HAVQRAQAQLGDVVVLSGAGTLGLGMIGALKKSGPSKIVVLDMKEDRLKLAKEFGADIVL
NPKEVDVVQEIKDMTEGYGCDIYIEASGHPKSVEQGLHAIRKLGRFVEFSVFSEPVTVDW
SIISDRKELDLLGSHLGPYCYPIVIDSIANGDFPTEGVVTHQLKLEKFEEGFELMKKGEN
SLKVILKP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaatgaaacagtagaaacaaaagaagcgaattcgacagttcctgaaaaaatgaaagcg
gttgtagcatacgcaccgaaagattatcgatatgaagaagtaagtacgccggaaatcgaa
aatgataaagaaatcattattaaattggaagcatgtggcatctgtgcgggggatataaaa
gcatatgacggtgcaccaagtttttggggagatgaaacacagccggcttatataaaagct
ccgatgattccgggtcatgaattcatcggtcacattgttcaaaaaggggatgcagtgaca
gattttgaaattggagaccgtgtaatctctgaacagatcgttccctgctgggattgcagg
ttctgtaacagaggtcagtactggatgtgtgaaaaacacgatctgtacggtttccaaaag
aatgtgaacggcggcatggctgaatatatgaagtttacaaaagaagcaattaacttcaaa
gtgccggaagaactgccgattgagcaagccattttaattgaaccttatgcctgcagcctc
catgcagtacagagagctcaagcccagctgggggatgtggtagtcctctccggcgcaggc
acactgggtcttgggatgatcggtgccctcaagaaatcggggccgagtaaaatagttgtc
ctggatatgaaggaagaccggcttaaactcgcaaaggaattcggagcggacattgtattg
aatccaaaggaagtggacgttgtacaggaaatcaaggatatgactgaaggctacggttgt
gacatctatattgaagcttcaggacatcctaaatctgtagagcaggggcttcatgcaatc
aggaaattaggccgcttcgtagaattcagtgttttttccgaaccggtaaccgtggactgg
agcatcatcagtgaccgcaaggagttggatcttctgggatcccatcttggcccttattgc
tatccgattgtcatagacagtatcgcaaacggcgatttcccgactgagggtgtagtgaca
catcaattaaaattagaaaaatttgaagaaggctttgagcttatgaaaaaaggtgaaaat
tcattgaaagtgattttgaaaccgtag

DBGET integrated database retrieval system