KEGG   Shewanella sp. W3-18-1: Sputw3181_0049Help
Entry
Sputw3181_0049    CDS       T00453                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00260  Glycine, serine and threonine metabolism
shw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sputw3181_0049
Enzymes [BR:shw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Sputw3181_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C HI0933_like Pyr_redox_3 FAD_binding_2 Pyr_redox_2 TrkA_N Methyltransf_25 FAD_oxidored UDPG_MGDP_dh_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABM22902
UniProt: A1RE07
LinkDB All DBs
Position
complement(62354..63379)
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKAEKGIWLVDAPKPVMGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTIPVPMV
VGHEYVGEVVDIGQEVRGFNIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGS
FAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSKESLKDVMKELGMTEGFDVGLEMS
GVPSAFHAMLDTMNHGGKIAMLGIPGGEMAIDWSKVIFKGLVIKGIYGREMFETWYKMAS
LIQSGLDISPIITHHFKIDDFQQGFDAMGSGQSGKVILSWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactaagcaagttaaaagccgaaaaaggtatttggttagtcgatgcgcctaag
ccagtcatgggccacaacgatctactgatcaaaattaagaaaaccgcgatttgtggcacc
gacatgcacatctacaactgggatgaatggtcgcaaaaaacgattccagtacctatggtt
gttggccatgagtatgttggcgaagtggttgatatcggccaagaagtccgtggttttaac
ataggcgaccgtgtctctggcgaaggtcatatcacctgcggccactgccgtaactgccgt
gctggccgcactcatttatgccgcaacacctcaggtgtcggtgtgaaccgtgaaggttca
ttcgccgaatatctggttattccagcctttaacgcctttaaaattcctgatgatatcagc
gatgatttagcgtccatcttcgatccgtttggtaacgctgtgcacactgcactgtcattc
gatttggtcggtgaagacgtgctgatcacaggcgctggccccatcggcattatggctgcg
gccgtatgtcgtcacgtcggtgctcgccatgtagtgatcaccgacgtcaacgaataccgt
ttagagctggcccgtaaaatgggggccactcgcgcagtgaacgtgtctaaagaaagcctg
aaagatgtgatgaaagaactcggtatgaccgaaggttttgatgtcgggttagaaatgtct
ggtgtaccatcggccttccacgccatgttagataccatgaaccacggcggcaaaatcgct
atgctcggtattccaggtggcgaaatggccatcgactggagcaaagtgatcttcaaaggt
ttagtgattaaaggtatctacggccgtgaaatgttcgaaacttggtacaagatggcaagt
cttatccaatcgggtttagatatttcacccatcatcactcaccacttcaagattgatgat
ttccaacaaggtttcgacgctatgggctcgggccaatcgggtaaagtgatcctcagctgg
gattaa

DBGET integrated database retrieval system