KEGG   Shewanella sp. W3-18-1: Sputw3181_0385
Entry
Sputw3181_0385    CDS       T00453                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00300  Lysine biosynthesis
shw00550  Peptidoglycan biosynthesis
shw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Sputw3181_0385
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sputw3181_0385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shw01011]
    Sputw3181_0385
Enzymes [BR:shw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sputw3181_0385
Peptidoglycan biosynthesis and degradation proteins [BR:shw01011]
 Precursor biosynthesis
  Amino acid ligase
   Sputw3181_0385
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: ABM23236
UniProt: A0A6N3J0P7
LinkDB
Position
415496..416998
AA seq 500 aa
MMLLRDLLAPWFIYSGDQSFNELTLDSRAIRRGDVFLALPGYRVDGRQFIDKALDLGAAG
VLVHTDDADQHGKVLLGDNAERGVQIYFFQLNRQVSAIAAQRYPLAHQFAVTPSLGIIGI
TGTNGKTSTSQLIAQLVTSLRRKAAVMGTLGNGLWGELVDSGNTTADAITLMRQLHEFEA
QGASVCAMEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHGDMESYATAKQSLFRFSTL
GHGLLNLDDPVGASWLIELKDMAAQIWGFSIEGHQAAAFYTKNTQFDDQGVSTTLVWPEG
ETQIHSPLLGAFNLSNLLAALSALYLQGFDMEALAEQVQYLTPVAGRMERFTTADNITLV
VDYAHTPDAIEQALTALRRHCAGDLWCVFGCGGDRDKGKRPLMGRAAEQYADRIMVTSDN
ARSEDPAQIISDIIQGLVTPERALTQVDRITAIKDVVGLAKSGDLILLAGKGHETYQEAA
GVRHNYDERALARQLAEQSK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgatgttgctacgggacctgttagcgccttggtttatatattcgggtgatcagtctttc
aatgagttgaccttagatagccgcgcaatacgccgcggcgatgtgtttttggcgttgcca
gggtatagggtcgatggcagacagtttattgataaagccttagatttaggtgccgcaggc
gtattagttcacacggatgatgctgaccaacatggcaaagtgttgcttggcgataatgct
gagcgtggtgtgcagatttattttttccaattaaatcgtcaggtatcagcgatagcagcc
cagcgttatcccttagcgcaccagtttgccgttacgccatcccttggcattatcggcatt
accggcaccaatggtaaaacctcaactagtcaactcattgcacagctagtgacgtcattg
aggcgaaaagctgctgttatgggtacattgggaaatggcctatggggtgaactagttgat
agcggtaataccactgccgatgcgattaccctaatgcgtcagttgcatgaatttgaagcc
caaggcgcgagcgtttgtgctatggaagtgtcgagccacgggctagtgcaaggccgcgtc
gatgcagtaccattcgatgtcgccgtgttcactaacttaacgcgcgatcacctcgattac
cacggcgacatggaaagctatgccaccgctaagcagagcctatttcgtttcagtacctta
ggtcacggtttattgaatctcgatgaccccgttggtgcatcttggttgattgagcttaaa
gacatggctgcacagatctggggctttagtatcgaaggccaccaagccgccgctttttat
accaaaaatactcagtttgacgatcaaggcgtaagtacaactttagtgtggcccgagggc
gaaactcaaattcactcaccacttcttggtgcctttaatctctctaatttactcgcggcg
ttatcggccttgtatctgcaaggttttgatatggaagccttagccgagcaagtgcaatat
ttaacgcctgttgcgggtcgtatggagcgttttactacggcggataacatcaccttagtc
gtcgattatgcacatacacccgatgcgatagagcaggcattaacggccttgcgccgccat
tgtgcgggggatttatggtgcgtgtttggttgcggtggagaccgcgataagggcaagcgc
cctttgatggggcgtgccgctgagcaatatgcagaccgtattatggtgaccagtgataat
gcacgcagcgaagatcctgcacaaattattagcgatattatccaagggcttgtcactcca
gaacgagcattgactcaggttgaccgtatcacagcaattaaagacgttgtgggattggct
aaatctggcgatctgatcttacttgcgggcaaaggccacgaaacttaccaagaggcggca
ggcgtgcgtcataactatgatgaacgcgctttggcacgccagttagcggagcaatcaaaa
tga

DBGET integrated database retrieval system