KEGG   Shewanella sp. W3-18-1: Sputw3181_0388
Entry
Sputw3181_0388    CDS       T00453                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00471  D-Glutamine and D-glutamate metabolism
shw00550  Peptidoglycan biosynthesis
shw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Sputw3181_0388
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sputw3181_0388
Enzymes [BR:shw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Sputw3181_0388
Peptidoglycan biosynthesis and degradation proteins [BR:shw01011]
 Precursor biosynthesis
  Amino acid ligase
   Sputw3181_0388
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C MeaB
Other DBs
NCBI-ProteinID: ABM23239
UniProt: A0A6N3J0N7
LinkDB
Position
419467..420786
AA seq 439 aa
MQRQYSHIVLGLGATGLSVVRYLCGKGITPLVMDSRRQPPGADTLAASFPEVQLITGGFD
CRYLVQASQIIISPGIALDTAEVRAALDMGIEVIGDVELFAREIADRKPCVIGITGSNGK
STVTTLVGEMLREAGMAVAVGGNIGVPALDLLSENAEIFVLELSSFQLETTHSLNCVAST
CLNVTEDHMDRYSDMDAYRKAKLRLYHQSRSIIFNRDDALTIPTEPMNQNSFGLAPPEGD
EWGICDSKIYHGRSEIMPITEVSLIGSHNHANLLAAMALVYAVGVDKQVMAKVARTFTGL
SHRCEVVGIKGGVTYVNDSKATNVGATVAALDGLSDHLGDIILIAGGDGKGADFSPLVEP
LSKVTHLITLGRDGNKIAALKEGAIKVDSMAAAVAKAAALATSGDIVLLSPACASLDMYS
NFMARGDDFRNLVELLDGE
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcaacgtcagtattcacacatagtgttaggtttgggcgcaacggggttgtccgttgta
cgctatttgtgtggaaagggcattacgccactggtgatggatagccgtagacaacctccg
ggggcggatactcttgcggcctctttccctgaagtacagttaattacgggtggttttgat
tgtcgctatttagtacaagccagccaaattattattagcccaggcattgctctcgatacc
gctgaagtgcgtgcagcgttagatatgggaatagaggtcattggtgacgttgaacttttt
gccagagaaatcgcagaccgaaaaccctgcgtgattggtattactggctctaatggcaag
tcgacggtcacaaccttagtcggtgaaatgctgcgtgaagcaggcatggctgtcgctgtg
gggggcaatattggtgttcctgcactagatctgctgagcgagaatgcagagatttttgtg
cttgagctgtcgagcttccaactggaaaccactcacagcttgaattgcgtggcttcaact
tgcttgaacgtgacggaagatcacatggacagatacagcgatatggatgcctatcgcaaa
gcaaagctgcgtctgtaccatcaaagtcgctccatcatttttaaccgtgatgatgcgctg
actatacctaccgaacctatgaaccaaaacagctttggtttagcgccgccagagggcgac
gagtggggtatttgtgatagtaagatttatcatggtcgcagcgaaattatgccaattacc
gaagtgtcgctaattggcagtcataaccatgccaacttacttgcagccatggctctagtc
tatgccgtgggtgtagataagcaagtgatggcgaaggtagctcgcacctttactgggctc
tcacaccgctgtgaagtggttgggataaaaggcggtgtgacttatgtgaacgattccaag
gccaccaatgtgggcgcaacagttgccgcacttgatggtttaagcgatcacttaggcgac
attattttaattgctggcggtgatggcaagggggcggatttcagcccgctggttgagcca
ctgagcaaggtgactcatctgattaccttaggtcgtgatggcaataagattgctgcgctg
aaggaaggggctattaaagtcgactctatggctgcagccgttgccaaggcggctgcatta
gccacctcaggcgatatcgttttattatctcccgcctgtgcgagtctagatatgtacagt
aactttatggcgcgtggcgatgatttccgcaatctggtggagctgctcgatggcgagtga

DBGET integrated database retrieval system