KEGG   Shewanella sp. W3-18-1: Sputw3181_0391
Entry
Sputw3181_0391    CDS       T00453                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00471  D-Glutamine and D-glutamate metabolism
shw00550  Peptidoglycan biosynthesis
shw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Sputw3181_0391
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sputw3181_0391
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shw01011]
    Sputw3181_0391
Enzymes [BR:shw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     Sputw3181_0391
Peptidoglycan biosynthesis and degradation proteins [BR:shw01011]
 Precursor biosynthesis
  Amino acid ligase
   Sputw3181_0391
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C OKR_DC_1_N F420_oxidored
Other DBs
NCBI-ProteinID: ABM23242
UniProt: A1REZ7
LinkDB
Position
423078..424544
AA seq 488 aa
MTKTERYIQLRSMIPEMRRIKRIHFVGIGGAGMGGIAEVLVNEGYQVSGSDIAQNTVTDR
LCLLGAKIQIGHAADNVQQVDVVVVSTAINAENPEIIAAKELRIPIVRRAEMLAELMRYR
HGVAIAGTHGKTTTTSLIASVYGQAGRDPTFVIGGLLNSAGTNARLGTSRYLIAEADESD
ASFLHLQPMVSVVTNIEADHMDTYGGDFEKLKSTFVDFLHNLPFYGVAVVCIDDPVVREI
MPRIGRHLVTYGFSDDADVQALNFSQQGHQCRFTVRRKGKEDLDLLLNLPGQHNVLNALA
AIAVATEDEIDDSALIQALAEFQGIGRRFQHLGKFATPKGEVMLVDDYGHHPSEVAATIK
AARAGWPEKRLVMAYQPHRYTRTRDLYEDFIEVLSQVDCLLLLDVYSAGEAPITGADGRA
LCRSIRLRGQLDPIFIASPDQLAEVLPDVLQEGDLLLTQGAGNIGALSRQLAVTELGFAK
VEIAQVPA
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgactaaaacagaaagatacatacagctaagaagcatgatccccgaaatgcgccgtatt
aagcgtattcacttcgtcggcattggcggcgcgggcatgggcgggatagctgaagtgtta
gtgaacgaaggctatcaggtgagtggttcggatatcgcccaaaataccgtgactgacaga
ttgtgtttactcggtgcgaagatccaaattggtcatgctgctgacaatgtacagcaagtt
gatgttgttgtggtttcgaccgcgataaacgctgaaaatcctgaaattatcgccgctaaa
gagttacggatccctatcgttcgccgtgccgaaatgctggcggagttaatgcgttatcgc
catggtgtggcgattgcgggcacccatggtaaaactaccacaaccagtcttattgccagt
gtctatgggcaagcagggcgagatcccacttttgttattggtggcttacttaatagcgca
ggtactaatgcaagattgggcaccagtcgttacttgattgccgaagctgatgaaagtgat
gcaagcttcctgcatctgcagcctatggtcagcgtggtaaccaatattgaagccgatcat
atggatacctatggcggtgactttgaaaaactgaaatcgacctttgtggattttctgcat
aatttgccattctatggtgtggcagtcgtgtgtattgatgatcctgttgttcgtgaaatt
atgccgcgtattggtcgtcacttagtgacttatggttttagtgatgacgctgatgttcaa
gcattaaactttagccagcaaggccatcaatgccgttttacggtaagacgcaaaggtaag
gaagatttagatctgctgcttaacctgccaggtcagcacaatgtgctaaatgcgctggct
gcgattgcggtagcaaccgaagatgaaattgatgacagcgcccttattcaagccctagct
gagttccaaggcattggtcgtcgtttccagcatttaggtaagtttgccacacctaagggt
gaagtgatgttagttgatgactatggtcatcacccaagtgaagtggctgcaaccattaaa
gcagcacgagcaggctggccagaaaaacgcttagtcatggcctatcagccccatcgatat
acacgtacccgtgatttgtacgaagactttattgaggtgttatctcaggtggattgcctg
ctgttactcgatgtctacagtgcaggcgaggcacccattaccggtgccgatggtcgggca
ttgtgccgctcgattcgtcttcgcggccagcttgatcccatctttattgccagcccagat
cagctagccgaagtgctacccgatgtgttgcaggagggggatttattgttgacccaaggt
gcgggtaatataggcgccctgtcgcgccagttagcggtaacagaattaggctttgcaaag
gtagaaatcgcgcaggtgccagcgtga

DBGET integrated database retrieval system