KEGG   Shewanella sp. W3-18-1: Sputw3181_1468
Entry
Sputw3181_1468    CDS       T00453                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS aminotransferase
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00541  O-Antigen nucleotide sugar biosynthesis
Brite
KEGG Orthology (KO) [BR:shw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    Sputw3181_1468
Enzymes [BR:shw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     Sputw3181_1468
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase SelA DUF2795
Other DBs
NCBI-ProteinID: ABM24310
UniProt: A0A6N3J333
LinkDB
Position
1659095..1660204
AA seq 369 aa
MSNKNIPVTQPFLPELNEFIPYLEQIWDNRWLTNNGPFHQQLEAKLCEYLGVEHISLFNN
ATIALITALQSLRVTGEVITTPYSFVATSHSIMWNGLEPVFVDVDPTTFNIDPAKIEAAI
TPRTTAIMPVHCYSNPCDVEAIQNIADNYGLKVIYDAAHAFGVNYKGESLLKWGDLSILS
FHATKVFNTFEGGAIISPDAKTKQRIDRLKNFGIADELTVTAPGINGKMSEINAAFGLVQ
LKHIDNAMAQRRAVDVRYREALADVTGITLYKHDSNANSNFSYFPILVEADYPLSRDELY
DKLKNNHILSRRYFYPLISNMPMYRGLPSAAISYLPQANQLADKVLCLPIFNELTVDEQQ
QVIELIKGN
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgagtaataaaaatatccctgtcacccagccgtttttgccagagttaaatgagtttatc
ccctacctagaacaaatttgggataaccgctggttgactaacaatggaccctttcatcaa
caacttgaagctaagttgtgtgaatatcttggtgtagaacatatctccctgtttaacaat
gccacgattgccttgatcacggctcttcaatcattgcgtgtgacgggtgaagttatcacc
acgccttactcttttgtcgccaccagtcactcgattatgtggaatggcttggagccggta
tttgtcgatgtcgacccaaccacttttaatattgacccagccaaaatagaagctgctatc
actccacgcacaactgccattatgccagtgcactgctattccaatccttgcgatgtcgaa
gcgattcaaaatattgctgacaactatggtcttaaggtgatttatgatgccgcccatgcc
tttggagttaactataaaggcgaaagtttgctgaaatggggcgatctttctattttgagc
tttcacgccaccaaggtgttcaataccttcgaaggtggggctattatcagtccggatgcc
aaaaccaagcagcgtatcgatcgcttgaaaaactttggaattgccgatgaactgacggtg
acagcaccaggcattaatggcaagatgagtgaaatcaatgctgcttttggcttagtccag
ctcaagcatattgataatgcgatggcacaacgccgagctgttgatgtccgttatcgtgag
gcattggctgatgtaacaggcattaccctgtataagcacgatagtaacgctaatagcaac
ttctcttattttccgatcttggtcgaggcggattacccactcagtcgcgatgagctatat
gacaagcttaaaaataatcatattttatcgcgccgttatttttaccctctgatcagcaat
atgccgatgtatcgtggtttaccgagtgcagcgataagttatttgccgcaagccaatcaa
ttagcagacaaggttctttgtttaccaatttttaatgaattgactgtggacgaacaacag
caggttattgagttaattaaagggaattaa

DBGET integrated database retrieval system