KEGG   Shewanella sp. W3-18-1: Sputw3181_2224Help
Entry
Sputw3181_2224    CDS       T00453                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00473  D-Alanine metabolism
shw00550  Peptidoglycan biosynthesis
shw01100  Metabolic pathways
shw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sputw3181_2224
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sputw3181_2224
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sputw3181_2224
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shw01011]
    Sputw3181_2224
Enzymes [BR:shw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sputw3181_2224
Peptidoglycan biosynthesis and degradation proteins [BR:shw01011]
 Precursor biosynthesis
  Amino acid ligase
   Sputw3181_2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp Birna_VP2
Motif
Other DBs
NCBI-ProteinID: ABM25049
UniProt: A1RK54
LinkDB All DBs
Position
2572278..2573291
Genome map
AA seq 337 aa AA seqDB search
MSRINLLLLCGGGSAEHDISLMSANYFESSLAKSDQFSVLRVELDKLGQYRTAAGDECEL
TNNREIRFRDETKAPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLHQYDDEAISQAQTALANWGSIFIKAASQGSSVGCYKVDDS
SKVAQVLKDAFGYAPYVVVEKTIKARELEVAVYEYNGEIVATLPGEIICDTNTFYTFDEK
YAKSSKARTDVVAKDVSVELSEQIRAYAIKAFKGMKLRHLSRIDFFLTAENEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINNQLSAKD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaattaacttacttttgctgtgcggcggcggaagtgctgaacacgatatttca
ctaatgtcggctaactattttgaatcctcattggcaaaatccgatcaattttccgtgtta
cgggtagaacttgataaattgggtcaatatcgcaccgcggcaggcgatgagtgtgaactg
acgaataatcgcgaaatccgttttcgcgatgaaactaaagcgccttggcctgtggactat
gttattccttgcatccatggttatcccggcgaaacaggtgatatccagtcctatttcaac
cttatccaactgccctacttcggctgtgaatccgaagccagtagtaattgttttaataaa
atcaccgccaaaatgtggttttcagccctagggatccccaatactccctacatttttcta
caccaatatgatgatgaggcgatcagccaagcacaaactgccttggctaattggggttca
atctttattaaagccgcgtcgcaaggatcgtctgtcggttgctataaagtggatgacagc
agcaaagtggcacaagtactcaaagatgccttcggctacgcaccctatgttgtcgtggaa
aaaaccattaaagcccgtgaattagaagtcgcggtatacgaatacaatggtgagattgtg
gcaaccctgccaggtgaaattatctgtgataccaataccttctacacctttgatgaaaaa
tacgccaaaagcagtaaggcacgcaccgatgtggttgcaaaagatgtttctgtagaactc
agtgaacagatccgtgcttatgctatcaaggcatttaaggggatgaagctgcgtcacctg
tcacgtatcgactttttcttaaccgctgaaaatgaaattttgctcaacgaaatcaacaca
ttccctggttcgacaccgatttcaatgttccctaaaatgttgcaaaaccacggccacgac
tttaccgaatatttaagcctagtgatcaacaaccagttatcggcaaaggattaa

DBGET integrated database retrieval system