KEGG   Shewanella sp. W3-18-1: Sputw3181_2679Help
Entry
Sputw3181_2679    CDS       T00453                                 

Definition
(GenBank) ABC transporter related
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
shw  Shewanella sp. W3-18-1
Brite
KEGG Orthology (KO) [BR:shw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shw02000]
    Sputw3181_2679
Transporters [BR:shw02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Sputw3181_2679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N SbcCD_C DUF4162 AAA_15 CysG_dimeriser AAA_23 Mg_chelatase AAA_16 AAA AAA_28 Rad17 AAA_22 AAA_29
Motif
Other DBs
NCBI-ProteinID: ABM25501
LinkDB All DBs
Position
complement(3052950..3053903)
Genome map
AA seq 317 aa AA seqDB search
MSQTDFVIQTQGMTRAFGGINAVENLDLAIPKGTIYGFLGPNGCGKSTSIRMLTGLLSPT
SGNIRVLGETLPGAEEKLRRRIGYMTQKFSLYDNLSVRENLEFVAQIYGLTRRQSQQRLA
ELLTLYDLVGREKQMAGSMSGGQRQRLALAAATLHHPELLFLDEPTSAVDPENRREFWER
LFDLCAQGTTILVSTHYMDEAERCHGLAILERGIKRADGSPQQLMAAMGARVLEVSGDDL
RTLKQSLMSESAVLSAAQIGSRLRVLVRSDIADPLAWLKPKIANRAMEEVRASLEDVFVT
CTGERLAAHAKEASHVA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaccgattttgttattcagacccaagggatgacccgcgcctttggtggtatt
aatgcggtagaaaaccttgatttagccattcccaaggggacaatttacggatttctcggc
cccaatggctgtggaaaatccacctcgatccgtatgttgactgggctactgagcccaacg
tccgggaatattcgtgtcttgggtgaaaccttacccggcgccgaggaaaaattacgtcgc
cgcattggctatatgacgcagaaattctccctatacgataatctttcagtgcgggaaaac
cttgagtttgtcgcgcaaatttatgggcttacccgccgtcagtcccagcagcgcttagcg
gagttattgacgctttacgatttagtcggccgcgagaaacaaatggcgggctccatgagt
ggcggtcagaggcagagattagccctcgcggccgcgactttacatcacccagaattgttg
tttctcgatgaacccacctcggctgttgatcctgaaaatcgccgcgagttttgggagcgg
ttgttcgatctctgcgcccaaggcaccacgatactggtgtcgactcactatatggatgag
gccgagcgttgccacggtttagcgattttggagcgggggataaagcgcgccgatggttca
ccgcagcaattgatggcggccatgggcgcacgggtactcgaagtttcgggtgatgattta
cgcacattaaaacaatcgctgatgagtgagtctgccgtgttgtcggcggcgcaaattggt
agtcgtttacgggtattagtgcgaagcgatatagccgatccgttagcttggcttaaacca
aaaatcgcaaatagagcgatggaagaagtgcgtgccagcctagaggatgtgtttgtgact
tgcacgggcgagcgcttggccgctcacgccaaggaggctagccatgtggcgtag

DBGET integrated database retrieval system