KEGG   Shewanella sp. W3-18-1: Sputw3181_3277Help
Entry
Sputw3181_3277    CDS       T00453                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shw  Shewanella sp. W3-18-1
Brite
KEGG Orthology (KO) [BR:shw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sputw3181_3277
Enzymes [BR:shw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sputw3181_3277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored NAD_binding_7 Glutaredoxin DAO Thi4 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABM26091
LinkDB All DBs
Position
3742531..3744102
Genome map
AA seq 523 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLANDIVSLSSLVSLKEVQGERT
PAMTVINPELKTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFE
TYVSLTCQNCPDVVQALNMMAAINPNITNVMIDGALFQEEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTNAASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLTTDGLFELE
LASGAKLRSRTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGERHHIALAGIFVQIGLVPNAEWLKGTVELTPRGEIIVDERGQTSVPGVFAA
GDVTNSPFKQIIIAMGSGATASLGAFDYLIRHSDEETAETKAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctacctgcaaaacctcaagagacca
gttgaacttgtcgtgtctgcagatgagagcaaaaagtctcaagaattaaaaagtttagct
aatgacattgtcagcctatcttctctggtgagcctgaaagaagttcagggcgaacgcacc
ccggcgatgacagtgataaacccagaacttaaaacgcaaatcagctttgctggtctgcct
atgggtcacgaatttacctcactcgtgctggcattactgcacacgggtggacacccaatc
aaactgagcgatgatatcatcgagcagatccgcaatctgccgggcaaatatgcctttgaa
acttatgtatcactgacctgccaaaactgcccagacgtagttcaggcactgaatatgatg
gcggccattaacccgaatatcaccaacgtgatgattgatggtgccctattccaagaagaa
gtagcgagccgtaatattatggccgtaccttctgtctacttaaatggcgaagtgtttgcc
gcaggtcgcatcagcataggtgagattttaaataaactggacaccaatgcagccagccgc
aaggccgatgaaattaatgaaaaagcccccttcgaagtcttagtcgttggcggcggcccc
gctggcgcagcagcagccatttatgcagcacgtaaaggacttcgcactggtattgttgcc
gacaagtttggcggccaagtcgctgaaaccgtgggtatcgagaactttatttcggtcaaa
gcgaccgaaggtccaaagctagtagcgaaccttgaagcccatgtgcgtgactatgaagtt
gatatcatggataatcaaaaagccgtgtcattgacgactgacggtttgttcgaacttgaa
ctggcaagcggcgctaaattacgtagccgtaccgtattgctggcaacaggcgctcgctgg
cgcgaaatgaacgtccccggtgagaaagaataccgtggtaaaggcgtggcttactgccca
cactgtgacggcccattatttaaaggcaagcgtgtggcggtgatcggcggcggtaactca
ggtatcgaagcggctatcgaccttgcgaacatagtagaacatgtaacagtactggaattt
gataaaaccctgcgcgccgacgatgtgctgcaacgtaaagccgcatctatgggtaacatt
aaaatcattacccaagcgatgaccactgaagtgacgggcgatggcactcgggtgaatggc
ctaaactacaccgaccgcgcaacgggtgaaaggcaccatatcgcgctggcagggatcttc
gtgcagattgggctagtacccaatgcggaatggttaaaaggcacagtggaattaacccca
aggggcgaaatcatcgtcgatgaacgcggccaaacctctgtaccaggcgtgtttgcagca
ggtgacgtgactaactcaccgtttaagcaaattatcattgccatgggcagcggcgcgacc
gcatcactgggggcatttgattacttaattcgccacagcgatgaagaaaccgccgaaacg
aaagccgcataa

DBGET integrated database retrieval system