KEGG   Shewanella sp. W3-18-1: Sputw3181_3861Help
Entry
Sputw3181_3861    CDS       T00453                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00620  Pyruvate metabolism
shw00680  Methane metabolism
shw01100  Metabolic pathways
shw01120  Microbial metabolism in diverse environments
shw01200  Carbon metabolism
Module
shw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:shw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sputw3181_3861
  09102 Energy metabolism
   00680 Methane metabolism
    Sputw3181_3861
Enzymes [BR:shw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sputw3181_3861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 SOCS DUF3666
Motif
Other DBs
NCBI-ProteinID: ABM26665
LinkDB All DBs
Position
4419271..4421940
Genome map
AA seq 889 aa AA seqDB search
MSVNAADNMTDMYASLRSNVSMLGQILGDTMRTHLGDSFLEKVEQIRKLAKDSRRGDQAA
REQMLELLTALPDEELVPFAKAFNQFLNLANLSEQFHTISRNCDELVCVPDPVEQLLGRM
LNGRIDQTKMLDCLKTLDIDLVLTAHPTEISRRTLIQKYAAIVDCLTEQENDQLSDRERQ
QINLRLRQLIAQIWHTNEIRRERPTPVDEARWGLSTIEESLWHAVPDFLRQLNDQVQQRT
GQQLPIDIAPVRFSSWMGGDRDGNPFVTSKVTQEVLDRNRHAAARLFLKDIVLLVGELSM
EEANDELKAYTNNNCEPYRHVLRSLRQRLRDTIDYLNARIEGHNPEVDKSSLIWQESDLK
VPLEMLYKSLTDCGMRLIANGLLLDILRRLACFGIHMLRLDIRQDASRHSDVLAELTRYL
GMGDFNHWDETEKQAFLLRELSNRRPLIPSNWQPSADVAEVLNTCRLIAKHPAKALGSYV
ISMAGKPSDVLTVLLLLKETGCSHPMRVVPLFETLSDLNNAAACITDLLDIDWYRGYTKG
MQEVMIGYSDSAKDAGVMAAAWAQYRAQEQLVAVCKQAGVKLTLFHGRGGSIGRGGGPAH
KAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVLEATLLPPPEPKQEW
RNCMQRIAEESVGAYRGIVRDEPDFVAYFRAATPEVELGKLPLGSRPAKRRVDGGIESLR
AIPWIFAWSQNRLMLPAWLGAGEALQAASERGEMGLLQDMEREWPFFSTRISMLEMVYAK
AEPNLARYYETCLVPKDLHHLGETLRQRLDLGIKVVLELTKSDSLMAHTPWNRESVKLRN
PYIDPLNFLQTELLARTRKETTETPASEHVQLALMLTIAGVAAGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaacgcggcagacaatatgacagatatgtatgcgtcattaagatcgaacgtg
agtatgttaggccaaatccttggcgatactatgcgaacccatcttggggactcttttctt
gagaaagttgaacagatccgtaagcttgccaaagactcacgcagaggcgatcaagcagcc
agagagcaaatgctcgagttactcacggcactgccagacgaagaattagtcccttttgca
aaggcattcaatcagttccttaacttagccaatttatctgaacaatttcatactattagt
cgcaattgtgacgagcttgtctgcgtacctgatccagtagaacaactcctaggtcgtatg
ctcaatggtcggattgatcaaacaaagatgctcgactgtctaaaaacactggatattgat
ctagtgctaacagcgcaccccactgaaatatcccgtcgcaccctgatccaaaagtatgca
gccatcgtcgactgcctaacagagcaagaaaacgaccaactgtcggatagggaacgtcaa
cagatcaatctgcgcctgcgccaattaatcgcgcaaatatggcacaccaatgagatccgc
cgtgagcgcccaacacctgtggatgaagcccgctggggattatccaccattgaagagtca
ctctggcatgcggtgcctgacttcttaagacaacttaacgaccaagtgcagcaacgtaca
gggcagcaattaccgattgatatcgcaccagtgcgcttttcaagctggatgggcggcgat
cgcgacggcaacccctttgttacctcaaaagtcacccaagaggtgctcgatcgtaaccgc
catgccgccgccagactattcttaaaagatatcgtgctgctggtcggtgaactgtcgatg
gaagaagccaatgatgagttaaaggcttataccaacaataactgcgagccctatcgccat
gtattacgctcacttcgtcaaaggctgcgcgataccatagattatttaaatgcacgcatc
gaaggccacaatcctgaagtcgataagtcgagcctgatctggcaagaaagcgatctcaaa
gtaccgttagaaatgctttataagagtttaaccgactgtggcatgcgcttaatcgccaac
ggtttattgctcgatattctccgtcgcctcgcttgctttggcattcacatgctcagactc
gacattcgccaagacgctagccgtcatagcgatgtgctcgccgagttaactcgttacctc
ggcatgggtgatttcaatcattgggatgaaaccgagaaacaagccttcctattacgcgaa
ctcagcaaccgtcgtccactgatcccaagtaactggcaaccctcggccgatgtggccgaa
gtgcttaatacctgtcgtttgattgctaaacatccggccaaagcactcggatcctatgtg
atttcgatggcgggtaaaccatcagatgtcttaacggttttactgttactcaaagaaacg
ggctgttcgcacccaatgcgcgtggtaccgctatttgaaaccttaagcgacttaaacaat
gctgcggcatgtattactgatttgctcgatatcgactggtatcgtggttacacaaaaggc
atgcaagaggtcatgattggttactctgactcagccaaagatgctggcgtcatggcggca
gcttgggctcagtatcgtgcccaagaacaattggtcgcggtttgtaaacaagcgggtgtc
aagctcacactattccatggccgtggcggcagcattggtcgcgggggtggtccagcacac
aaagcgattctatcccaacctccggggtcggtagatggccgtattcgtgtcactgagcag
ggcgaaatgatccgcttcaagtttggcttgccaaaactcgcggttcaaagcttagcctta
tatacctctgccgtattggaagcaaccctgctaccaccgccagagcctaaacaagaatgg
cgcaattgcatgcaacgcatcgctgaagaatccgtgggtgcataccgtggtatagtgcga
gatgaaccggatttcgtggcttatttccgcgcggcaacgccagaagtggaattaggaaaa
ctgccacttggcagccgcccagctaaacgtcgtgtcgatggtgggattgaaagcctacgg
gccattccgtggatttttgcttggtcgcaaaaccgcttgatgttacctgcatggcttggc
gccggtgaagcacttcaagccgccagtgaacgcggtgaaatgggtttactgcaagatatg
gagcgggaatggcccttcttcagcactcgcatttcaatgctagaaatggtctacgccaag
gcggaacctaatttagcccgctactacgaaacctgtttagtaccgaaagacttgcatcat
ttaggcgaaaccttgcgccaacgcttagatctgggcattaaagtcgtgcttgaactgaca
aaatcagatagcttaatggcgcatacgccgtggaatcgcgagtctgttaagctgcgaaat
ccgtatatcgatccattaaacttcttacaaaccgagctattagcgcggacacgtaaggaa
acaaccgaaactcccgcgtctgaacatgtacagttagcgctaatgctgaccattgcaggt
gtggcagcgggaatgagaaacactggttaa

DBGET integrated database retrieval system