KEGG   Schistosoma haematobium: MS3_00004Help
Entry
MS3_00004         CDS       T05004                                 

Definition
(RefSeq) Lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
shx  Schistosoma haematobium
Pathway
shx00052  Galactose metabolism
shx00500  Starch and sucrose metabolism
shx01100  Metabolic pathways
shx04142  Lysosome
Brite
KEGG Orthology (KO) [BR:shx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MS3_00004
   00500 Starch and sucrose metabolism
    MS3_00004
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    MS3_00004
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shx04147]
    MS3_00004
Enzymes [BR:shx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MS3_00004
Exosome [BR:shx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MS3_00004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NtCtMGAM_N Glyco_hydro_31 Trefoil
Motif
Other DBs
NCBI-GeneID: 24587861
NCBI-ProteinID: XP_012791665
UniProt: A0A094ZCF5
LinkDB All DBs
Position
Unknown
AA seq 467 aa AA seqDB search
MQAIIIGFTLSFISTFKSAESYPQCSNITNVQRLDCYPNFGSNEGGCIKRGCCWVPKSGN
NELPYCYFPKDYSAYIVLSTEKTKRGFIGQLSKPNPTYYPDEIKSIAVEIREETSTRLRI
RFTVPSQPDRWEPPIPLGNADDTPVKNVQYKVDMEKSPFGLKIIRNTKEQDVLLDSTGQL
ASSLIFSDQFLQISFRVNAHVSFGPGEIEQKYPNAFDTWTRIALWGHDGNPQSSYLNGTT
VARALAFEFPEDLATHKVDSQFMLGSCILVTPVLDEGRTFVEGYVPSGEWIELSAGKRYF
SRGTWKYFDAPLNVIPISIRCGCIVPIQVSAETTDIARKKGFGLFVILSSTDDGSSAAGQ
RITASGELFWDNGDDANLNYVHVKFEVRDRTLTVTSTPSSVESLEKIDLKELDVKTILIV
GFIKKPAAILVNNKPVDFIFDNDLETCQIKNQSFLTLSKEFIIKWRF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctataatcattggatttaccttatccttcattagtaccttcaaatctgcagaa
tcttatcctcaatgttcaaatattaccaatgttcaacgtttagattgttatccaaatttt
ggttctaatgaaggtggatgcatcaaaagaggatgttgttgggtgcctaaaagtggaaat
aatgaattaccatactgttattttccaaaagattattctgcatatattgtattatcaact
gagaaaactaaacgtggctttattggacaattgagcaaacctaatccaacctattaccca
gatgaaataaaaagtattgccgttgaaattagagaggagacttccactagacttcgtata
cgatttactgtaccttcacagccagacagatgggaaccacctattccattgggaaatgcg
gatgatactcctgtaaaaaatgttcaatacaaagttgacatggagaaatcaccctttgga
ttaaagataataagaaatactaaagagcaagatgtacttttggactcaactggacagttg
gctagttcgcttatattttcagatcagtttttgcagatatcatttcgtgtgaatgctcat
gtaagctttggtcctggggaaatagaacaaaaatatccaaacgcctttgatacgtggacg
cgaatagctctttggggtcacgatggaaatccacagtcatcgtacttaaatggaacaact
gtggctcgtgctctcgcattcgagttccctgaagacttggccacacataaagtcgattca
caattcatgctcggatcgtgtattttggttactccagtgctagatgagggtcggacattc
gttgagggttacgttccatcaggagaatggattgaactatccgctggcaaacggtatttc
agtcgaggtacatggaaatacttcgatgcacctctgaatgtcattccgatttctattcgt
tgtgggtgtatagttccaatacaagtttctgctgaaacaacagatatcgctcgtaagaag
ggatttggtttatttgtgatcttgtcttcaactgatgatggaagtagtgctgctggacag
agaatcacagcatcgggtgaattattctgggataatggagatgatgctaatttaaattat
gtacatgtgaaatttgaagtacgtgatcgtactttaacagtgacttctacaccttcgagt
gttgaaagtttagagaaaattgatttgaaagaactggatgttaagactattcttatagta
ggtttcattaaaaagcctgcagcaattcttgttaacaacaaaccggtagattttatattt
gataatgacttggaaacttgtcaaattaaaaatcaatcctttttaactttaagtaaggaa
tttataatcaaatggagattttga

DBGET integrated database retrieval system