KEGG   Schistosoma haematobium: MS3_05953Help
Entry
MS3_05953         CDS       T05004                                 

Definition
(RefSeq) Rho-related GTP-binding protein RhoC
  KO
K07857  Ras homolog gene family, member C
Organism
shx  Schistosoma haematobium
Brite
Membrane trafficking [BR:shx04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    MS3_05953
Exosome [BR:shx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MS3_05953
GTP-binding proteins [BR:shx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    MS3_05953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 24593374
NCBI-ProteinID: XP_012797376
UniProt: A0A094ZWR5
LinkDB All DBs
Position
Unknown
AA seq 192 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSTDSLDNITEKWYPEVKHFCPNVPIILVGNKQD
LRNDERAHHELAKVRQELVKSEEGRLVCDRINAYGYLECSAKTKEGVRKVFETATRAALN
TKRKRKKGCELV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatccgtaagaaactggttattgttggtgatggagcttgtggaaagacgtgt
ttgctcattgtctttagcaaagatcagtttcccgaagtgtatgtgccaactgtcttcgaa
aactacgtcgctgatatcgaggtggatgggaagcaagtagagttggcgctttgggatacc
gcgggtcaagaagactacgatagacttcgacctttgtcatatcccgacactgatgtcata
ttaatgtgtttttcaatagacagcactgacagtctcgataatatcactgagaaatggtat
cctgaagtaaaacacttctgtccaaatgttccgatcatccttgtgggtaacaaacaagat
ctgcgtaatgatgagcgagcgcatcatgaattagccaaagttcgtcaggaattagtcaaa
tccgaagaaggtcgccttgtatgtgatcgtattaatgcttatggatatttagagtgttcc
gctaaaacaaaagaaggtgttcgtaaagtttttgaaacagctacacgtgctgctttaaat
actaaacgtaaaagaaagaaaggctgtgaacttgtttaa

DBGET integrated database retrieval system