KEGG   Schistosoma haematobium: MS3_06690
Entry
MS3_06690         CDS       T05004                                 

Definition
(RefSeq) Ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
shx  Schistosoma haematobium
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2
Other DBs
NCBI-GeneID: 24594060
NCBI-ProteinID: XP_012798071
UniProt: A0A094ZU23
LinkDB
Position
Unknown
AA seq 522 aa
MSSLLCELELANEIPVSICYGINTDYLTAHQDVIASPIIPPSTTTSSNNSDVDPIHRADE
QHQNSRSVSPTCCSSLLLPPPVPWNLDLTTSEVNETTPSLFVNNSNDMILRNDYYQGKID
IGYKFNDGLFNGDTTQQHACKNVDNNNHSRCRSKDSLLSDDINFLNNSCNTHHNYPNYDN
KPLGLLSPSHHLNFDSFEISEMTNSNTYAFSTFDSDCLAWMRLTVHDVTNNTNEDMNNSS
ELQLPNLDTLSRPCVHHWVDIFNSNPLGLRLNFVDDSCRLAGTLRIYINLIKPVKMSLRR
TLDMFPSSATASPEPNSPTKLNLNENGDENNAVPTPPRLVSFFLPRGTSKVVYVTSSTTS
ANAIQSLLDRFHIQESARKFALYEHTLEDSSISARKLTTTECPLLLLLNWVRISTNREQF
LELLKQKRIVLQENDACDIEWKDFTTAELTNFLRILDKEECEYRNAILYQYNLLRNQLEQ
RMKQLAEMHNTRDILPVYNPFFLWEKNNAVPFTNAYIHFFLL
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtcttcattgttatgtgaacttgagttagctaatgaaataccagtatccatctgttat
ggaataaatactgattatttgacagctcatcaagatgtaatcgcttctcctattatacct
ccatctacaactacttcttcgaataattcagatgttgatccaattcatagagcagatgaa
caacaccagaatagtagatcagtttctccaacatgttgtagctctctcttattacctcca
cctgttccatggaatttggatttaacaacatctgaagtgaatgaaacaacaccaagttta
tttgttaataatagtaatgatatgattttaagaaatgattattatcaaggtaaaatagat
attggatataaatttaatgatggtttatttaatggtgatactacacaacaacatgcttgt
aaaaatgtcgataataataatcattcgagatgtcgaagtaaagattcactcctttcagat
gacataaactttttaaataattcatgcaacactcatcataattatccgaattatgataat
aaaccacttggattattatcaccaagtcatcatttgaattttgatagttttgaaatttct
gaaatgactaatagtaatacatatgcttttagtacattcgattcagattgtctagcatgg
atgcgtttaactgtacatgatgtaacaaataatacaaatgaagatatgaataattcatca
gaattacaattacctaatttggatacattatctcgaccatgtgttcatcattgggtggat
atattcaactcgaatcctttaggtttacgattaaattttgtggatgattcttgtcgactt
gctggcactctacgcatttatattaatcttattaaaccggtgaaaatgtctttaagacgt
acattggatatgtttccatcaagtgcaacagcgtcacctgaaccaaatagtccaactaaa
ttgaatttaaatgagaatggggatgagaataatgctgtaccaacaccaccacgtttagtt
tcattttttctaccaagaggtacttcaaaagtagtttatgtgacaagttctacgacttca
gctaatgctattcaatcgttgttagatcgatttcatatacaagaatctgctcgtaaattc
gccttgtatgaacatactttagaagatagttcaattagcgctcgaaaacttactacaact
gaatgtcctcttctattattattaaattgggtacgtataagtacaaatcgtgaacaattc
ttagagttgttgaaacaaaaacgtattgtactacaagaaaatgatgcttgtgatatagag
tggaaagactttacgacagcagaattaacaaatttcctacgtatacttgataaagaggaa
tgtgaatatcgtaatgctattctatatcaatataatttgttgcgtaatcaactagaacaa
cgtatgaaacaattagctgaaatgcacaatacacgagacattttacctgtgtacaatcct
ttttttctgtgggaaaagaataatgctgtaccctttacaaatgcatacatacattttttt
ctcttataa

DBGET integrated database retrieval system