KEGG   Schistosoma haematobium: MS3_09233Help
Entry
MS3_09233         CDS       T05004                                 

Definition
(RefSeq) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
shx  Schistosoma haematobium
Pathway
shx04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:shx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MS3_09233
Enzymes [BR:shx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MS3_09233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 24596425
NCBI-ProteinID: XP_012800510
UniProt: A0A095A0L7
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MKAVCVMTGTAGVKGVVKFTQETDNGPVNVHAEFSGLKAGKHGFHVHEFGDTTNGCISAG
AHFNPTKQEHGAPEDSIRHVGDLGNVVAGVNGNAVYNATDKLISLNGPHSIIGRTMVIHE
NEDDLGRGGHELSKVTGNAGARLACGVIGLASE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtttgtgttatgactggtacagctggcgtaaaaggcgttgtcaaattcact
caggaaactgacaatggacctgttaatgtgcacgccgaatttagtggactcaaggctggt
aaacatggctttcatgttcatgaatttggtgatacaacaaatggatgtatttcagctgga
gctcatttcaatccaactaaacaagagcatggagcaccagaagatagtattcgtcatgtt
ggtgacctgggtaatgttgtggcgggtgttaatggaaacgcagtttataacgcgactgac
aaattgatatctttgaacggccctcattcaataattggtcgaactatggtcattcatgaa
aatgaagatgatttaggccgtggtggacatgagctcagtaaagtaactggtaatgctggt
gcccgtctagcttgtggcgttatcggtttagcttctgagtag

DBGET integrated database retrieval system