KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_0850Help
Entry
SHJG_0850         CDS       T02063                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEY86127
UniProt: H2JTM6
LinkDB All DBs
Position
1030272..1031711
Genome map
AA seq 479 aa AA seqDB search
MITYDKLYIGGRWTEPAKKDLLEVRSPHDRSLVGLAAEATKPDVDLAVDAARKAFDEGPW
PRLSPAERQNVIARFNDLYAKRTEEIADLTTAENGSARWFTGWTAAALPQQTDAFLRAAA
VLPWEEELPRTDGAPGRILVRREPVGVVAAVIPWNAPHQSALVKIVPALLAGCTVVLKTS
PENALVTLLLGEILTAAGVPEGVVSILPADRATSEYLISHPGIDKIAFTGSTGAGRTIAA
IAGRQLKRVSLELGGKSAAIVLEDADLDAMAEGLKFHSFANNAEACVAHTRILVHRSRYD
EAVARLKDLVESLTVGDPSDPATFIGPMVRADQQERVRSYIETGIREGARLVTGGPEVPA
GLEDGYYVTPTLFADVDNSMRIAQEEIFGPVLVVIPFDDDDHAVRIANDSPYGLGGGVWT
ADEDRALEIARRIRTGTFSVNGAPFSFDAPFGGFKSSGIGREFGAAGLTQYVEYKTVAV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacttacgacaagctgtacatcggcggacgctggaccgagcccgccaagaaggac
ctgctggaggtccgctccccgcacgaccggtccctggtcgggctggccgccgaggccacg
aagcccgatgtggacctcgccgtcgacgccgcccgcaaggccttcgacgaaggcccctgg
ccgcgcctgtccccggccgaacgccagaacgtcatcgcccgcttcaacgacctctacgcc
aagcgcaccgaggagatcgcggacctcaccaccgccgagaacggcagcgcgcgctggttc
accggctggaccgccgccgccctgccccagcagaccgacgccttcctgcgtgccgcggcc
gtcctgccgtgggaggaggaactgccgcggaccgacggtgccccgggccgcatcctggta
cgccgcgaaccggtcggtgtcgtagcggccgtcatcccctggaacgccccgcaccagtcc
gcgctcgtcaagatcgtccccgctctcctggcgggctgcaccgtcgtgctcaagacatcg
cccgagaacgccctcgtcacgctgctgctgggggagatcctcaccgcagcgggcgtgccg
gagggcgtggtcagcatcctgccggccgaccgcgccaccagcgagtacctcatctcccac
cccggtatcgacaagatcgcgttcaccggttcgacgggcgccggacgcaccatcgcggcc
atcgccggccggcagctcaagcgggtgagcctggagctcggcggcaagtccgccgccatc
gtgctggaggacgccgacctcgacgccatggcggagggcctgaagttccactccttcgcc
aacaacgccgaagcctgcgtcgcgcacacgcggatcctcgtgcaccgcagccgctacgac
gaggccgtggccaggctgaaggacctcgtcgagtcgctgaccgtcggcgatccctccgac
cccgcgaccttcatcgggccgatggtcagggcggaccagcaggagcgcgtgcggtcgtac
atcgagacgggaatccgcgagggcgcccggctcgtcaccggcggccccgaggtccccgcc
ggtctggaggacggctactacgtcacccccaccctcttcgccgacgtcgacaactccatg
cgcatcgcccaggaggagatcttcggtcccgtgctcgtggtcatccccttcgacgacgac
gaccacgcggtccgcatcgccaacgattccccgtacggcctcggcggcggcgtgtggacg
gccgacgaggaccgcgccctggagatcgcccggcgcatccgcaccggcaccttctccgtc
aacggcgcgccgttctccttcgacgcccccttcggagggttcaagagcagcggcatcggc
agggagttcggcgcggccggcctgacccagtacgtcgagtacaagacggtcgcggtctga

DBGET integrated database retrieval system