KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_1202
Entry
SHJG_1202         CDS       T02063                                 

Definition
(GenBank) aromatase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy01056  Biosynthesis of type II polyketide backbone
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
Module
shy_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SHJG_1202
Enzymes [BR:shy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     SHJG_1202
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc UQCC3
Other DBs
NCBI-ProteinID: AEY86479
UniProt: H2JZP5
LinkDB
Position
1440123..1441073
AA seq 316 aa
MARRTVHRTEESTRIAAGAEVVRALIEDVEGWSHLHPTAVHAEYVERKGTESLIRQWALV
DERSVRHWLMRRWDKDDTIAFAHEPAAPPFAEVRGAWTFESVDGGAAVVVRMEHEFVLLE
EDAAAADRQREKLRQGSLAYLKTLKHAAENREDIRRRTLTFEDPLFIAGSVQDAYTYLLE
ADKWPQRMPHVAALTLEEPGPGVQFFDMDTSDPDGGHRHSTRSVRICLSPRLIVYKQIKL
PVLLTAHTGHWSFTEIPEGVIATTRHTATVKESALGVLGEGTTVQDARNYLRHVLTDNSM
SNLRLTKEYAEGRAGR
NT seq 951 nt   +upstreamnt  +downstreamnt
atggcacgtcgcaccgttcaccgcaccgaggagagcacccgcatcgccgcgggcgcggag
gtggtccgggccctcatcgaggacgtcgagggctggtcgcatctgcatcccacggccgtg
cacgccgagtacgtggagcggaagggcaccgagagcctgatccggcaatgggcgctggtc
gacgagcggtcggtacggcactggctgatgcgccggtgggacaaggacgacacgatcgcc
ttcgcccacgaaccggccgccccgccgttcgccgaggtccggggcgcgtggacgttcgag
tccgtcgacggcggcgcggccgtggtggtccgcatggagcacgagttcgtcctccttgag
gaggacgccgcggcggccgaccggcagcgggagaagctgcggcaggggtccctggcctac
ctgaagaccctcaagcacgccgcggagaaccgggaggacatccgccgccgcacactgacc
ttcgaggatccgctgttcatcgccgggtcggtgcaggacgcgtacacctatctgctggag
gccgacaagtggccgcagcggatgccgcacgtggccgccctcaccctggaggagcccgga
cccggcgtgcagttcttcgacatggacacctccgacccggacggggggcaccggcactcc
acccgctcggtgcggatctgcctgtctccgcgcctgatcgtctacaagcagatcaagctg
ccggtcctgctgaccgcgcacaccgggcactggtccttcaccgagatcccggagggtgtc
atcgccaccacccggcacacggccacggtcaaggagtcggcgctcggagtgctcggcgag
ggcacgaccgtccaggacgcccggaactacctgcgtcacgtactgaccgacaacagcatg
agcaacctgcggctcaccaaggagtacgcggaggggcgtgcgggccggtga

DBGET integrated database retrieval system