KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2464Help
Entry
SHJG_2464         CDS       T02063                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SHJG_2464
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SHJG_2464
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SHJG_2464
    1.1.1.-  
     SHJG_2464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AEY87739
UniProt: H2JZU1
LinkDB All DBs
Position
2965203..2966261
Genome map
AA seq 352 aa AA seqDB search
MKAARFYGPGDIRIDDVQEPATRPGTVKVEVEWCGICGTDLHEYLEGPIFAPAIGRPHPL
TGETVPITLGHEFAGVVRELGDGVGDLRVGDRVVVEPYVVCGRCDPCLRGMYNVCQSLGF
VGLSGGGGGFSQFVVAERRWIHPLGELGTDVGALIEPLAVAYHAVRLSGARSADTAIVFG
AGPIGLVTTAVLRAVGTESIIVVEPADVRKAKAVMAGADHILDPATTDIATAVSELTKGR
NADVTFECAGIDAVLKSAILSTRAGGTCVNVAIWGHEARVALNDLVFREVKVLGSLAYAN
DHPATISLVASGRVDPYQFITGRIGLDDIVTSGFDELVDNKEENVKILVRPH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacgcttctacggtccgggcgacatccggatcgacgatgtacaggaacca
gcgacacggccgggcaccgtcaaggtcgaggtcgaatggtgcggcatttgcggcaccgac
ctccacgagtatctggaaggtcccattttcgcgccggccataggcaggccgcaccccctg
acgggcgagaccgtgcccatcactttgggtcacgagttcgcgggagtggtccgggaactc
ggtgacggtgtcggtgacctgcgcgtgggcgaccgggtcgttgtcgaaccctacgtcgtg
tgcggccggtgcgacccctgtctgcgcggcatgtacaacgtctgccagtcgctgggattc
gtcggcctctccggcggaggaggcggattctcacaattcgtcgtagccgaacgccgctgg
atccacccgctcggcgaactcggcacagacgtgggggcgctcatcgagccactcgcggtc
gcctaccacgccgtacggctgtccggcgcccggtccgccgacaccgccatcgtgttcggt
gcgggaccgatcggcctggtgaccacggctgttctgcgtgcggtcggcaccgagtcgatc
atcgtcgtggagcccgcggacgtacgcaaggccaaagcagtcatggccggcgccgaccac
atactcgatccggccactacggacatcgctacggcggtgtcggaactgaccaagggccgc
aacgccgacgtgaccttcgaatgcgccggcatcgacgcggtgctcaagtccgcgatcctt
tccacacgcgcgggcggcacctgcgtgaacgtcgccatctggggacacgaggccagggtc
gcactgaacgatctggtgttccgcgaggtcaaggtgctcggcagcctcgcatatgcgaac
gaccacccggcgaccatttccctggtcgcgagcggccgggtcgacccgtaccagttcatc
accggccggatcggtctggacgacatcgtcacgagcggcttcgacgaactggtggacaac
aaggaggagaacgtcaagatcctggtccgcccgcactga

DBGET integrated database retrieval system