KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3519Help
Entry
SHJG_3519         CDS       T02063                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shy00405  Phenazine biosynthesis
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01130  Biosynthesis of antibiotics
shy01230  Biosynthesis of amino acids
shy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SHJG_3519
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SHJG_3519
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SHJG_3519
Enzymes [BR:shy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SHJG_3519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N Phage_holin_3_1
Motif
Other DBs
NCBI-ProteinID: AEY88791
UniProt: H2JVH7
LinkDB All DBs
Position
complement(4096128..4097606)
Genome map
AA seq 492 aa AA seqDB search
MELETFRKLATDRRVIPVTRKLLADGDTPVALYRKLAAERPGTFLLESAENGRSWSRYSF
VGVRSAATLTARDGHAHWLGTPPVGVPTDGDPLAALRATLQALHTPHQEGLPPFTGGMVG
YLGYDIVRRLEKIGPGERDDLGLPELTMLLTSDLAVMDHWEGSVLLIANAINHNDLDTGV
DEAYADAVARLDAMEADLSRPVAQPPAHLPPSELPEYTARWGGPDFQRAVEDVKERIRAG
EAFQVVPSQRFETPCTAGALDVYRVLRATNPSPYMYLFRFDGFDVVGSSPEALVKVEDGR
AMVHPIAGTRHRGATPQEDQALAEELLADPKERAEHLMLVDLGRNDLGRVCEPGSVEVVD
FMSVERYSHVMHIVSTVTGTVAPGRTAFDVLTACFPAGTLSGAPKPRAMQIIDELEPSRR
GLYGGCVGYLDFAGDSDTAIAIRTALLRDGTAYVQAGAGIVADSDPVAEDQECRNKAAAV
LRAVHTANRLGA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaactggagaccttccgcaagctggccaccgaccggcgtgtcatcccggtcacgcgc
aagctgctcgccgacggcgacaccccggtcgcgctgtaccgcaagctcgccgccgagcgc
cccggcaccttcctgctggagtccgcggagaacggccgttcctggtcccgttactccttc
gtcggcgtccgcagcgccgccacgctcaccgcgcgggacggacacgcccactggctcggc
accccgcccgtcggcgtccccaccgacggcgaccccctcgcggccctgcgcgccaccctc
caggccctgcacaccccgcaccaggagggcctgccgcccttcaccggcggcatggtcggc
tacctgggctacgacatcgtccgccgcctggagaagatcggccccggcgaacgcgacgac
ctggggctgcccgagctgaccatgctgctgaccagcgacctcgcggtgatggaccactgg
gagggctcggtcctgctgatcgccaacgcgatcaaccacaacgacctcgacaccggcgtc
gacgaggcgtacgcggacgccgtcgcccggctcgacgccatggaggccgacctctcccgc
ccggtcgcccagcccccggcccacctgccgccctccgagctgcccgagtacaccgcccgc
tggggcggccccgacttccagcgggccgtcgaggacgtcaaggagcgcatccgcgcgggc
gaggccttccaggtcgtgccctcccagcgcttcgagaccccgtgcacggccggcgccttg
gacgtctaccgggtcctgcgggccaccaacccctcgccgtacatgtacctcttccgcttc
gacgggttcgacgtcgtcggctcctccccggaagcgctggtgaaggtcgaggacggacgc
gcgatggtccaccccatcgccggcacccggcaccgcggggccaccccgcaggaggaccag
gccctggccgaggaactcctcgccgaccccaaggaacgcgccgagcacctgatgctggtc
gacctcggccgcaacgacctcggccgggtctgcgagcccggctcggtcgaggtggtcgac
ttcatgtccgtcgagcgctactcccacgtgatgcacatcgtctcgaccgtcaccggcacg
gtcgcccccggccgcacggccttcgacgtgctcaccgcctgcttcccggccggcaccctc
tccggcgcccccaagccccgcgcgatgcagatcatcgacgaactggagccgtcccggcgc
ggcctgtacggcggctgcgtcggctacctggacttcgccggcgactccgacaccgcgatc
gccatccgtacggccctgctccgcgacggcacggcctacgtccaggccggtgccggcatc
gtcgccgactccgacccggtcgcggaggaccaggagtgccgcaacaaggccgcggcggtg
ctgcgggccgtgcacaccgccaaccggttgggcgcgtag

DBGET integrated database retrieval system