KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4461Help
Entry
SHJG_4461         CDS       T02063                                 

Definition
(GenBank) transferase
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: AEY89732
UniProt: H2JQ45
LinkDB All DBs
Position
5133591..5135255
Genome map
AA seq 554 aa AA seqDB search
MTRPDVTVTVIVYNDAARLPRAVASLRAQTHANIEIVISDDHSTDETPAVARELAAQDHR
IRYIRLPENSGGCSAPRNRAIEIARAPYLMFLDSDDELPPRAVESLLAAHRERDVDFTMG
AVRRVRVDNGRRSTWMPHLVAERRTLEGIEADPRLLFEHLSTSKMYARAFLDRHQLRFPE
GIHYEDQLFSAQAYCLAEAFTIIPEPVYVWYIEPFADASSASISNQRHKISNVADRVHVQ
RLIDEFLVSSGHAGLREDKDYKFLKHDFRMYAGDLPYRDEEWLTSFAEIMNPYLDTLSPE
AYGRLPRAERVVLELLRDGRLAEARLAARGLGHAVAPRRVTTDGAGVPYWGDTVPSTDRA
RRELDVSELELDTRPFPTALFRHEITELTPGAGATLTLAIRTYDPGLRLPVGPQRASLLL
SPGRRRMTVPFRLDPVRPGVFEGTVRLDLVSAPVPLHGFQGVRHPVVRLDQQGLSHSGLL
LAPLDFPARTARIDYHSGAAPHELTVEPEGRNPGRLQLRWRPVGVTARITRPAIRRLARP
RVRNAARLVASALK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccccgacgtcacggtcacggtcatcgtctacaacgacgcggcccgcctgccc
cgcgcggtcgcctcgctgcgcgcgcagacccacgcgaacatcgagatcgtcatcagcgac
gaccactcgacggacgagacccccgcggtggcccgggagctggcggcccaggaccaccgc
atccgctacatccggctgcccgagaacagcggcgggtgcagcgccccgcgcaaccgggcc
atcgagatcgcccgggcgccgtacctgatgttcctcgacagcgacgacgaactcccgccg
cgcgccgtcgagtcgctgctcgccgcgcaccgcgagcgggacgtcgacttcaccatgggc
gcggtccgccgggtccgggtggacaacggccgccgctcgacctggatgccgcacctggtc
gccgagcgccgcacgctggagggcatcgaggcggacccgcgtctgctcttcgagcacctg
tcgacgagcaagatgtacgcgcgcgccttcctcgaccggcaccagctccgcttccccgag
ggcatccactacgaggaccagctgttctcggcgcaggcgtactgcctggcggaggcgttc
acgatcatcccggagccggtgtacgtctggtacatcgagccgttcgcggacgcgtcctcc
gcgtccatctccaaccagcggcacaagatctccaacgtggccgaccgggtgcacgtccag
cggctgatcgacgagttcctggtgagcagcgggcacgcggggctgcgggaggacaaggac
tacaagttcctcaagcacgacttccggatgtacgccggtgacctgccgtaccgggacgag
gagtggctgacgtccttcgcggagatcatgaacccctacctggacacgctctcccccgag
gcctacggccggctgccgcgcgccgagcgggtggtgctggagctgctgcgggacggccgc
ctggccgaggcccggctggcggcgcgcgggctggggcacgcggtggcaccgcggcgggtg
acgaccgacggtgcgggggtcccgtactggggtgacaccgtgccctcgacggaccgcgcc
cgccgcgaactggacgtgtccgagctggagttggacactcggccgttcccgaccgccctg
ttccggcacgagatcacggagctgacgcccggcgcgggggcgaccctgaccctggcgatc
cgcacctacgaccccggcctgcgcctgccggtcgggccccagcgcgcgtccttgctcctc
agccccggccggcgccgtatgacggtccccttccgtctggacccggtccgccccggcgtc
ttcgagggcacggtccgcctcgacctcgtgtccgcgccggtcccgctccacggtttccag
ggcgtacggcaccccgtggtccgcctggaccagcagggcctgtcccactcgggtctgctc
ctggccccgttggacttcccggcccgcaccgcccgcatcgactaccactccggcgcggcc
ccccacgaactcaccgtcgaaccggaaggccgcaaccccggccgcctccagctccgctgg
cgtccggtgggggtgacggcccggatcacccggcccgccatccgccgtctggcccgaccc
cgcgtccggaacgccgcacggctggtggcaagtgcgctgaagtaa

DBGET integrated database retrieval system