KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4599Help
Entry
SHJG_4599         CDS       T02063                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00620  Pyruvate metabolism
shy00680  Methane metabolism
shy01100  Metabolic pathways
shy01120  Microbial metabolism in diverse environments
shy01200  Carbon metabolism
Module
shy_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SHJG_4599
  09102 Energy metabolism
   00680 Methane metabolism
    SHJG_4599
Enzymes [BR:shy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SHJG_4599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEY89870
UniProt: H2JSW0
LinkDB All DBs
Position
complement(5300614..5303346)
Genome map
AA seq 910 aa AA seqDB search
MSSADDQTTTTSSELRADIRRLGDLLGETLVRQEGPELLELVEKVRRLTREDGDAAAELL
RGTELDTAAKLVRAFSTYFHLANITEQVHRGRELRARRAAEGGLLARTADRLKDADPEHL
RQTVQNLNVRPVFTAHPTEAARRSVLNKLRRIAALLDTPVLDTDRRRHDVRLAENIDLVW
QTDELRVVRPEPADEARNAIYYLDELHADAVGDVLEDLTAELERVGVKLPDDTRPLTFGT
WIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGLLSNSIRYTGATDELLDSL
KTDLELLPEISPRYKRLNAEEPYRLKATCIRQKLENTKQRLAKGTPHEEGRDYLGTGELL
KDLRIIQASLREHRGGLFADGRLARTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRL
GEESWRYADMPRDYRARLLAKELRSRRPLAPTPAPVDAAAQKTLGVFETVKRALEVFGPE
VVESYIISMCQGADDVFAAAVLAREAGLLDLHAGWAKIGIVPLLETTDELKAADTILEDM
LSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLF
HGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAAT
LQASALHTAPRQSDEALARWDAAMDVVSDAAHAAYRRLVEDPDLPTYFLASTPVDQLAEL
HLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALRETGLDSVLGEM
HEQWHFFRNFISNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDTIKAEHELTVHEVLRIT
GEQELLDAQPVLKQTFAIRDAYLDPISYLQVALLKRQRDAAAAGTDPDPLLSRALLLTVN
GVAAGLRNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccaccacgaccagcagcgagctgcgcgccgacatccgc
cggctgggtgatctcctgggggagaccctcgtccggcaggaaggccccgagctcctcgaa
ctggtcgaaaaggtccgccgcctcacccgcgaagacggtgacgccgccgccgagctgctg
cgcggcaccgaactggacaccgcggccaagctggtccgcgccttctccacctacttccac
ctcgccaacatcaccgaacaggtgcaccggggccgcgaactgcgcgcccggcgcgccgcc
gagggcggcctgctcgcccgcacggccgaccggctcaaggacgccgaccccgagcacctg
cggcagaccgtccagaacctcaacgtccgcccggtcttcaccgcgcaccccaccgaggca
gcgcgccgctccgtcctcaacaagctccggcgcatcgccgcgctcctggacacccccgtc
ctcgacaccgaccgccgccgccacgacgtccgcctcgccgagaacatcgacctcgtctgg
cagaccgacgagctgcgcgtcgtacgccccgaacccgccgacgaggcccgcaacgcgatc
tactacctcgacgagctgcacgccgacgccgtcggagacgtcctggaggacctgaccgcc
gaactggagcgcgtcggcgtcaagctccccgacgacacccgccccctcaccttcggcacc
tggatcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtgacctgggacgtc
ctcatcctccagcacgaacacggcatcaacgacgccctggagatgatcgacgagctgcgc
ggactgctctccaactccatccgctacaccggcgccaccgacgagctcctcgactccctc
aagaccgacctggagctgctccccgagatcagcccccgctacaagcgcctcaacgccgag
gagccctaccggctcaaggccacctgcatccggcagaagctggagaacaccaagcagcgc
ctcgccaagggcaccccgcacgaggagggccgcgactacctcggcaccggcgagctgctg
aaggacctgcgcatcatccaggcctccctgcgcgagcaccgcggcggcctgttcgccgac
ggccgcctcgcccgcaccatccgcaccctggccgccttcggcctccagctcgccaccatg
gacgtccgcgaacacgccgacgcccaccaccacgccctcggccagctcttcgaccggctc
ggcgaggagtcctggcgctacgccgacatgccccgcgactaccgcgcccggctcctcgcc
aaggaactgcgctccagaaggccgctcgcccccaccccggcccccgtcgacgccgccgcg
cagaagaccctcggcgtcttcgagaccgtcaagagggccctggaggtcttcggccccgag
gtcgtcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgccgcc
gtcctcgcccgcgaagccggactgctggacctgcacgccggctgggccaagatcggcatc
gtccccctcctggagaccaccgacgagctgaaggccgccgacaccatcctggaggacatg
ctctccgacccgtcctaccggcgcctggtcgcgctgcgcggcgacgtccaggaggtcatg
ctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgggagatccac
cgcgcccagcgccggctgcgcgacgtcgcccaccgctacggcgtacgcctgcgcctcttc
cacggccgcggcggcaccgtcggccgcggcggtggcccctcccacgacgccatcctcgcc
cagccctggggcaccctggagggcgagatcaaggtcaccgaacagggcgaggtcatctcc
gacaagtacctcatcccctccctcgcccgggagaacctggaactgacggtcgcggccacc
ctccaggcctccgccctgcacaccgcaccccgccagtccgacgaggccctcgcccgctgg
gacgcggccatggacgtcgtctccgacgccgcccacgccgcctaccgccgcctggtcgag
gaccccgacctgccgacgtacttcctcgcctccacgcccgtcgaccagctcgccgagctg
cacctgggctcgcggccctcccgccgccccggctcgggcgtctcgctcgacggcctgcgc
gccatcccgtgggtgttcggctggacccagtcccggcagatcgtgcccggctggttcggc
gtcggctccggcctcaaggcgctgcgggaaaccggtctggacagcgtgctcggcgagatg
cacgaacagtggcacttcttccgcaacttcatctccaacgtcgagatgaccctcgccaag
acggacctgcggatcgcccagcactacgtcgacaccctcgtccccgacgagctcaagcac
gtcttcgacaccatcaaggccgaacacgagctgaccgtccacgaggtcctgcggatcacc
ggcgagcaggaactgctggacgcccagccggtcctcaagcagaccttcgccatccgcgac
gcctacctggacccgatctcctacctccaggtcgccctgctcaagcggcagcgcgacgcc
gccgcggccggcaccgaccccgacccgctgctctcccgcgccctgctcctcaccgtcaac
ggcgtggcggcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system