KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4870Help
Entry
SHJG_4870         CDS       T02063                                 

Definition
(GenBank) integral membrane transport protein
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_3 PTR2 MFS_1_like MFS_4 Nuc_H_symport
Motif
Other DBs
NCBI-ProteinID: AEY90138
UniProt: H2JX43
LinkDB All DBs
Position
complement(5593836..5595074)
Genome map
AA seq 412 aa AA seqDB search
MRRAVRESVSGLPREFWWLWTSTLVNRLGAFVATFMALYLTLDRGYSASYAGLVASLHGL
GGVVSSLGGGVMADRLGRRPTLLIAQTATAASVALLGFMTDPVAIAAVAFLVGMAANASR
PAVQAMMADIVRPEDRVRAFSLNYWAINLGFAVSSMAAGFIAEFSYLAGFLIEAGMTLAC
AVVVFAKVPESRPAATARQAEDSVSLGTVLRDGRYMAVVGLSFLVALVFQQGSVGLPVAM
GRAGLTPADYGLAIAVNGILIVALQIPVTRFIEHRDPRTLLVASSLLAGYGFGLTAFAGS
VGVFMVTVCVWTLAEIVNAPTQTGLVVRLSPVHGRGRYQGMYTLSWSVAALIAPLMSGVV
IDRLGAGWLWGMCAVVGTAAGLGYGVLMRRLPTERPAPAKARADTGSEVRAA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagacgtgccgtccgcgaatccgtctccgggctccccagagagttctggtggctgtgg
accagcaccctcgtcaaccggctgggcgccttcgtggccacgttcatggccctctacctc
acgctcgaccggggctactccgcctcgtacgccggtctcgtcgcctccctgcacgggctc
ggcggggtcgtctcctcgctgggcggcggggtgatggccgaccggctcggccggcggcct
acgctgctcatcgcgcagaccgccaccgccgcctcggtcgccctgctcggcttcatgacc
gacccggtcgcgatcgccgccgtcgccttcctcgtcggcatggccgccaacgcctcccgg
ccggccgtgcaggcgatgatggccgacatcgtccgccccgaggaccgggtgcgggccttc
tccctcaactactgggcgatcaacctgggcttcgccgtctcctccatggccgccgggttc
atcgccgagttcagctatctggccgggttcctgatcgaggccgggatgaccctggcctgc
gcggtcgtcgtcttcgccaaggtgccggagtcgcggccggcggccacggccaggcaggcg
gaggacagcgtcagcctgggcacggtgctgcgggacgggcggtacatggccgtcgtcggg
ctgtccttcctcgtcgccctggtcttccagcagggctcggtcggcctgccggtagccatg
gggcgggccggcctcaccccggccgactacggcctcgccatcgccgtcaacggcatcctg
atcgtcgccctccagatccccgtcacccggttcatcgagcaccgcgacccgcgcaccctc
ctggtcgcctcctcgctcctcgcgggatacggcttcgggctcaccgcgttcgccggctcg
gtcggcgtcttcatggtcaccgtgtgcgtgtggaccctggccgagatcgtcaacgccccg
acccagacgggcctcgtcgtccgcctctccccggtccacggccgcgggcgctaccagggc
atgtacaccctctcctggtccgtcgccgccctgatcgcgcccctgatgtcgggcgtggtc
atcgaccgcctcggcgccgggtggctgtgggggatgtgcgcggtggtggggacggcggcc
gggctcggctacggcgtcctgatgcgccgcctgcccacggagcggccggccccggccaag
gcgcgggcggacaccgggagcgaggtgcgcgcggcctag

DBGET integrated database retrieval system