KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5519Help
Entry
SHJG_5519         CDS       T02063                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00010  Glycolysis / Gluconeogenesis
shy00053  Ascorbate and aldarate metabolism
shy00071  Fatty acid degradation
shy00280  Valine, leucine and isoleucine degradation
shy00310  Lysine degradation
shy00330  Arginine and proline metabolism
shy00340  Histidine metabolism
shy00380  Tryptophan metabolism
shy00410  beta-Alanine metabolism
shy00561  Glycerolipid metabolism
shy00620  Pyruvate metabolism
shy00625  Chloroalkane and chloroalkene degradation
shy00903  Limonene and pinene degradation
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy01130  Biosynthesis of antibiotics
Module
shy_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_5519
   00053 Ascorbate and aldarate metabolism
    SHJG_5519
   00620 Pyruvate metabolism
    SHJG_5519
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SHJG_5519
   00561 Glycerolipid metabolism
    SHJG_5519
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SHJG_5519
   00310 Lysine degradation
    SHJG_5519
   00330 Arginine and proline metabolism
    SHJG_5519
   00340 Histidine metabolism
    SHJG_5519
   00380 Tryptophan metabolism
    SHJG_5519
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SHJG_5519
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SHJG_5519
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SHJG_5519
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SHJG_5519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AEY90786
UniProt: H2JM53
LinkDB All DBs
Position
6306720..6308180
Genome map
AA seq 486 aa AA seqDB search
MSSYFTDLARQYIDGEWRPGTGSWDVIDFNPYDDEKLASITVATVDEVDQAYQAAARAQK
KWAETSPYTRRAVFERALRLIEDREQEITDLIIAELGGTRVKAGFELHLAKEFLRESVHL
ALRPEGRILPSPGEGKENRVYRVPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPH
QNTPIAGGTLLAKIFEDAGLPGGLLNVVVTDIAEIGDAFLEHPVPKVISFTGSDKVGRHV
ATVCARNFKRAVLELGGNSALVVLDDADIDYAVDAAVFSRFVHQGQVCMAANRVLVDASV
ADEFTEKFVAKVRGLKVGDPRDPQTVIGPVINSAQAAAVSGTVEQALAEGATALVRGTTT
NNLVEPTVLTGVPAGSPLLQQEVFGPVVFLLTFDGEEEAVRIVNDTPYGLSGAVHTADIE
RGVAFAKRTETGMFHVNDGTVHDEPIVPFGGEKHSGLGRLNGETTLEAFTTVKWISVQHG
RSAFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctacttcaccgacctggcccggcagtacatcgacggcgagtggcggccgggc
accggctcctgggacgtcatcgacttcaacccctacgacgacgagaagctggcctcgatc
acggtggccacggtcgacgaggtggaccaggcctaccaggccgccgcccgcgcccagaag
aagtgggccgagaccagcccctacacccggcgcgcggtcttcgagcgggccctcaggctg
atagaggaccgcgagcaggagataaccgacctgatcatcgcggagctgggcggcacccgc
gtcaaggccggcttcgagctgcacctcgccaaggagttcctgcgcgagtcggtccacctc
gcgctgcgccccgagggccggatcctgccctccccgggcgagggcaaggagaaccgcgtc
taccgcgtgccggtcggcgtcgtgggcgtcatcagccccttcaacttcccgttcctgctg
tcgctgaagtcggtcgcgccggccctcgcgctcggcaacgccgtggtgctcaagccgcac
cagaacaccccgatcgccggcggcaccctgctcgcgaagatcttcgaggacgccgggctg
cccggcggcctgctcaacgtcgtcgtcaccgacatcgccgagatcggtgacgcgttcctt
gagcaccccgtcccgaaggtcatctccttcaccggctcggacaaggtcggccggcacgtc
gccaccgtctgcgccaggaacttcaagcgcgcggtcctcgaactgggcggcaacagcgcc
ctggtggtgctggacgacgccgacatcgactacgcggtggacgcggcggtcttcagccgg
ttcgtgcaccagggccaggtctgcatggccgccaaccgcgtcctcgtggacgcctcggtg
gccgacgagttcaccgagaagttcgtcgccaaggtccgcggtctcaaggtcggcgacccg
cgcgacccgcagaccgtgatcggcccggtgatcaactccgcgcaggcggccgccgtctcc
ggcaccgtggagcaggcgctcgccgagggcgccaccgccctggtgcgcggcaccacgacc
aacaacctggtcgagccgaccgtgctgaccggtgtcccggccggctccccgctgctccag
caggaggtcttcggcccggtcgtcttcctcctcaccttcgacggcgaggaggaggcggtc
cggatcgtcaacgacaccccgtacggcctcagcggcgccgtccacacggccgacatcgag
cgcggcgtggccttcgccaaacggaccgaaaccggcatgttccacgtgaacgacggcacg
gtccacgacgagccgatcgtgcccttcggcggtgagaagcactccggcctcggccgtctc
aacggcgagaccacgctggaggcgttcaccaccgtcaagtggatctcggtgcagcacggg
cgcagcgcgttcccgttctag

DBGET integrated database retrieval system