KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5870Help
Entry
SHJG_5870         CDS       T02063                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00564  Glycerophospholipid metabolism
shy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SHJG_5870
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SHJG_5870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AEY91137
UniProt: H2JT93
LinkDB All DBs
Position
6676971..6678626
Genome map
AA seq 551 aa AA seqDB search
MAERELDVLVVGGGVVGAGTALDAVTRGLSTGLVEARDWASGTSSRSSKLIHGGLRYLEM
LDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLYAGSGVALYDAMSMARGH
GRGLPVHRHLTRRHALRVAPCLKKDALVGALQYYDAQMDDARFVATLVRTAASYGAKVAN
RARVTGFLREGERVVGARVQDVEAGGEYEIHAQQVVNATGVWTDDTQAMVGERGRFHVRA
SKGIHLVVPKDRVHSTTGLILRTEKSVLFVIPWGRHWIIGTTDTDWDLDKAHPAASSADI
DYLLEHVNSVLAVPLSRDDVQGVYAGLRPLLAGESDATSKLSREHTVAHPVPGLVVVAGG
KYTTYRVMAKDAVDEAVHGLDMRVADCVTEETPLLGAEGYQALWNARARIAARTGLHVVR
VEHLLNRYGSLAEEVLDLIAADPSLGEPLHAADDYLRAEVVYAASHEGARHLDDVLTRRT
RISIETFDRGTRSAREAAELMAPVLGWDEDQIAREVEHYEKRVEAERESQLQPDDHTADA
ARLGAPDIVPL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcgcgagctggacgtgctggtggtcggcggcggagtggtgggcgccggtacc
gcgctggacgccgtcacgcgtggcctgtccaccggcctggtagaggcccgtgactgggcg
tccggcacctccagccgctccagcaagctgatacacggcggcctgcgctatctggagatg
ctcgacttcgccctggtccgcgaggccctcaaggagcgcggactgctgctggagcgcctc
gccccgcacctggtcaagccggtcccgttcctctacccgctccagcacaagggctgggag
cggctgtacgcgggctcgggcgtcgcgctgtacgacgcgatgtccatggcccgcggccac
ggccggggcctgcccgtgcaccgccacctcacccgccgccacgccctgcgggtggccccc
tgcctgaagaaggacgccctggtcggcgccctccagtactacgacgcccagatggacgac
gcccgcttcgtcgccaccctggtgcgcacggccgcgtcctacggcgcgaaggtggccaac
cgcgcgcgcgtgaccgggttcctgcgcgagggggagcgggtcgtcggcgcccgggtgcag
gacgtggaggccggcggggagtacgagatccacgcccagcaggtcgtcaacgccaccggt
gtgtggaccgacgacacgcaggccatggtcggcgagcgcggccggttccacgtccgcgcc
tccaagggcatccacctggtcgtgcccaaggaccgcgtccactccaccaccggcctgatc
ctgcgcaccgagaagtccgtcctcttcgtcatcccctggggccggcactggatcatcggc
accaccgacaccgactgggacctggacaaggcccacccggccgcgtccagcgccgacatc
gactatctgctggagcacgtcaactcggtgctggccgtgccgctcagccgcgacgacgta
cagggggtgtacgcgggactgcgcccgctgctggccggcgagtccgacgccaccagcaag
ctgtcccgcgagcacacggtcgcccacccggtgccgggactggtggtcgtggccggcggc
aagtacacgacgtaccgggtgatggccaaggacgccgtcgacgaggccgtgcacgggctc
gacatgcgcgtggccgactgtgtcacggaggagaccccgctgctcggcgcggagggctac
caggcgctgtggaacgcgcgggcgcggatcgccgcgcgcaccggactgcacgtggtccgc
gtggagcacctgctgaaccggtacggctcgctggccgaggaggtcctggacctcatcgcc
gccgacccctcgctcggcgagccgctgcacgccgccgacgactacctgcgcgccgaggtg
gtgtacgccgcctcgcacgagggcgcccggcacctggacgacgtcctcacgcgtcgcacc
cgcatctccatcgagaccttcgaccgcggcacccgcagcgcccgcgaggcggccgagctg
atggcacccgtcctcggctgggacgaggaccagatcgcccgcgaggtcgagcactacgag
aagcgggtggaggccgagcgggagtcccagctccagccggacgaccacacggcggacgcc
gcgaggctgggcgcgccggacatcgtgccgctgtag

DBGET integrated database retrieval system